Conserved Protein Domain Family
citE

?
TIGR01588: citE 
citrate lyase, beta subunit
This is a model of the beta subunit of the holoenzyme citrate lyase (EC 4.1.3.6) composed of alpha (EC 2.8.3.10), beta (EC 4.1.3.34), and acyl carrier protein subunits in a stoichiometric relationship of 6:6:6. Citrate lyase is an enzyme which converts citrate to oxaloacetate. In bacteria, this reaction is involved in citrate fermentation. The beta subunit catalyzes the reaction (3S)-citryl-CoA = acetyl-CoA + oxaloacetate. The seed contains an experimentally characterized member from Leuconostoc mesenteroides. The model covers a wide range of Gram positive bacteria. For Gram negative bacteria, it appears that only gamma proteobacteria hit this model. The model is quite robust with queries scoring either quite well or quite poorly against the model. There are currently no hits in-between the noise cutoff and trusted cutoff. [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 130649
View PSSM: TIGR01588
Aligned: 4 rows
Threshold Bit Score: 493.576
Threshold Setting Gi: 152968617
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144809    3 RLRRSMMFVPGSKPAMIRDCTIYGADSVMFDLEDSVSIAEKDSARRLVYHALTSMDFGDTETVVRVNALDSEFGIEDLKA 82
gi 19715030    6 RLRRTMMFLPGNNPSMITDAYIYGPDSVMIDLEDATSVNQKDAARFLVSEALKTIDYKTTETVVRVNGLDTPFGADDIRA 85
gi 3913247     5 RLRRTMMFVPGNNPAMVKDAGIFGADSIMFDLEDAVSLAEKDSARYLVYEALQTVDYGSSELVVRINGLDTPFYKNDIKA 84
gi 490253368   2 KPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVSLREKDTARLLVYQALQHPLYQDIETVVRINPLNTPFGLADLEA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144809   83 IVRAQPDVIRLPKTETAQDVLDMEKIIASIEEEIGLsIGKTKMMAAIESALGVLNAYEIATSSKRLMGIALGAEDFVTDM 162
gi 19715030   86 VVKAGVNVVRLPKTDTPNEIIAVDKLIPEVEKEIGR-EGETLLMAAIESATGIMNVKEIALASKRLMGIALGAEDYVTNL 164
gi 3913247    85 MVKAGIDVIRLPKVETAAMMHELESLITDAEKEFGRpVGTTHMMAAIESALGVVNAVEIANASDRMIGIALSAEDYTTDM 164
gi 490253368  82 VVRAGVDMVRLPKTDSKEDIHELEAHVERIERECGReVGSTKLMAAIESALGVVNAVEIARASPRLAAIALAAFDYVMDM 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144809  163 KTHRSPEGNELFAARSHIILASRAAKISAFDTVYSDVNNEEGFIKEATLIKQLGFDGKSLINPRQIDLLHKVFEPTEKEI 242
gi 19715030  165 KTSRSKHGWELYYAREAIVLAARNAGIYCFDTVYSDVNNLDGFRQEVQFIKDLGFDGKSCIHPKQVRIVHEIYTPTQKEI 244
gi 3913247   165 KTHRYPDGQELLYARNVILHAARAAGIAAFDTVFTNLNDEEGFYRETQLIHQLGFDGKSLINPRQIEMVNKVYAPTEKEI 244
gi 490253368 162 GTSRG-DGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLAEANLAKNLGFNGKSLVNPRQIELLHQVYAPTRKEV 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 18144809  243 DKAIKIIEAAKEAEKRGSGVVSLNGKMIDKPVIARAERVLMLAKASGI 290
gi 19715030  245 EKSIRIINGAKEAEAKGSGVISVDGKMVDNPIIMRAQRVLELAKASGI 292
gi 3913247   245 NNAQNVIAAIEEAKQKGSGVISMNGQMVDRPVVLRAQRVMKLANANHL 292
gi 490253368 241 DHALEVIAAAEEAETRGLGVVSLNGKMIDGPIIDHARKVVALS-ASGI 287
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap