Conserved Protein Domain Family
yir-bir-cir_Pla

?
TIGR01590: yir-bir-cir_Pla 
yir/bir/cir-family of variant antigens, Plasmodium-specific
This model represents a large paralogous family of variant antigens from several Plasmodium species (P. yoelii, P. berghei and P. chabaudi). The seed was generated from a list of ORF's in P. yoelii containing a paralagous domain as defined by an algorithm implemented at TIFR. The list was aligned and reduced to six sequences approximating the most divergent clades present in the data set. The model only hits genes previously characterized as yir, bir, or cir genes above the trusted cutoff. In between trusted and noise is one gene from P. vivax (vir25) which has been characterized as a distant relative of the yir/bir/cir family. The vir family appears to be present in 600-1000 copies per haploid genome and is preferentially located in the sub-telomeric regions of the chromosomes. The genomic data for yoelii is consistent with this observation. It is not believed that there are any orthologs of this family in P. falciparum.
Statistics
?
PSSM-Id: 130651
View PSSM: TIGR01590
Aligned: 6 rows
Threshold Bit Score: 207.343
Threshold Setting Gi: 82793571
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82793571   18 DELKNSEEYDIHGiHGIEEYCLDeesreK---KCKTELSNINATCLWLLNKNIANRiD-DLSNEQAKSVIIYIMIWLNYM 93
gi 82753646   19 DELKDSGEYDFKN-SLFKKYCPK-----G---SCNNDIDKINAGCLWLIYELFVKL-GfSAGQHVLKYDSVCIIIWLGYI 88
gi 675231619  18 DQLSRDGNYQFKSyNN-HSFCTNi--------NCETDIDKINAGCLWLFKAIFFDSySfKTYAKNNINMVEYIMIWLSYI 88
gi 82753786   18 DDLDKSVSLELKDhKSLKNYCPIt---gSgenECDNNLGKITAGFLWLLEQCYSISkNkKYKENNTNAFFLYMISWFSYK 94
gi 675229890  31 DELNSGEY-YFKGg-SLKRYCPKs----R---NCDNDIDKINSYCLWLFNQLYGDStDfSNNENDNIIIITFIFGWLSYK 101
gi 675232899  16 ivfDHNSQKYTFNgKLINN---Yc---pN---NCNNDDEKVSSAFIALVTLLNGIDdK---ENIGNDKLAEYAILWLSYI 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82793571   94 LNLK-NDGKINLNNFYT-IIEKNANYtnctngDNDCSNKLKgktgYNN-FKDVIVKNMDFSNINFEDISKFYDAFKLLCK 170
gi 82753646   89 ISLKpQDGINKLSDYYSkHIKDNAEY------SKHEIGNEK----YNN-YKNIIDEIQEYMDIDINDMPKFYKLLKLLCN 157
gi 675231619  89 LSLKkDNSIKNLKEFYDqYISNDKEY------TSPISGVEA----YYSsYKDLMDKKNGLMSIGIKDISKFYDAFKLLCE 158
gi 82753786   95 LNQIrGHDSTKINDFYTkHVINSHKY------DNFTNTAYR----FTE-LKEFIDERKDLLNINIDDLSKFYDAFKLLCN 163
gi 675229890 102 LNQKaENRITKLNEFYNkHMQNVQEY------NTSIENNTK----YKT-YIDLININKELMDIDISVMSKFYGVFKNLCK 170
gi 675232899  84 LNQKtQNGTTKLNDFYTnHIKNNSQY------DQYITTDSG----NKI-NKDVIEKKQDLMNMEIKDIYNFYDVFKSLCN 152
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 82793571  171 MHTESNDGNIecNQYLEYVNNIVDKFKKLNDDSSISGDSSYSKVWYTLSTDYDSFK 226
gi 82753646  158 MNTAYTEGKS--TEVLQHANDFVDEYGKLLNDDNNIKDSSYNKILNVLSIYYDKFG 211
gi 675231619 159 ICTEIDASTSncSNYLQKAKEFAKKYDDLNENYNNTKGSPYNQVLSTLSNDYNNIK 214
gi 82753786  164 IHGNAAKSASg-MTLSNDATHFFNEYTELNND-SKIEGTARNKILPVLSTDYDKLK 217
gi 675229890 171 MYNELSKTKIngEEYLKDVNDFVNNYNTLFND---KNSNLFKQILHAASNDYNYIK 223
gi 675232899 153 MYSEINETNYqcNKCLKNAGEFFEKFEKINNVYGTTEGSYYLELLSSLSTEYDKFK 208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap