2IV2


Conserved Protein Domain Family
Fdh-alpha

?
TIGR01591: Fdh-alpha 
Click on image for an interactive view with Cn3D
formate dehydrogenase, alpha subunit, archaeal-type
This model describes a subset of formate dehydrogenase alpha chains found mainly archaea but also in alpha and gamma proteobacteria and a small number of gram positive bacteria. The alpha chain contains domains for molybdopterin dinucleotide binding and molybdopterin oxidoreductase (pfam01568 and pfam00384, respectively). The holo-enzyme also contains beta and gamma subunits. The enzyme catalyzes the oxidation of formate (produced from pyruvate during anaerobic growth) to carbon dioxide with the concomitant release of two electrons and two protons. The enzyme's purpose is to allow growth on formate in some circumstances and, in the case of FdhH in gamma proteobacteria, to pass electrons to hydrogenase (by which process acid is neutralized). This model is well-defined, with only a single fragmentary sequence falling between trusted and noise. The alpha subunit of a version of nitrate reductase is closely related.
Statistics
?
PSSM-Id: 130652
View PSSM: TIGR01591
Aligned: 7 rows
Threshold Bit Score: 1056.68
Threshold Setting Gi: 15897897
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IV2_X         6 TVCPYCASGCKINLVVDNGKIVRAEAAQG-KTNQGTLCLKGYYGWDFIND----TqiltPRLKTPMIRRqrG--GKLEPV 78
gi 119886      8 TICPYCGVGCGMNLVVKDEKVVGVEPWKRhPVNEGKLCPKGNFCYEIIHR----E----DRLTTPLIKE--N--GEFREA 75
gi 18893655   11 VVCPYCGFGCNL---LVDTITKKVRPYRg-EPNRGKLCPKGLFALEHVYS----K----DRLRYPLKRE--G--SDFKRI 74
gi 182628291   6 TVCPYCASGCKINLVVDNGKIVRAEAAQG-KTNQGTLCLKGYYGWDFINDtqilT----PRLKTPMIRRqrG--GKLEPV 78
gi 497674834 262 TVCIYCGVGCSFEIWTKGRKILKIEPKPEsPANGILTCVKGKFGWDFVNS----S----ERITKPLIRE--G--DKFREA 329
gi 499215651 265 TTCAYCGVGCSFKAEVKDDEVIRMMPYKDgKANHGHSCVKGRFAYGYATH----K----DRILSPMIRE--KisDPWREV 334
gi 497675026   6 TICPFCGVGCGLDFYVENNFIFRVSPSQEhIVSRGHVCGKGAVASEVIYA----W----DRLTYPLKRV--K--DTFVRT 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IV2_X        79 SWDEALNYVAERLSaikeKYGPDAIQTTGSSRGTgNETNYVMQKFARAVIGTNNVDCCARVXHGPSVAGLHQSVGNGAMS 158
gi 119886     76 TWDEAYDLIASKLG----AYDPNEIGFFCCARSP-NENIYVNQKFARIVVGTHNIDHCARLCHGPTVAGLAASFGSGAMT 150
gi 18893655   75 SWERAISEIAEKIReiieNYGPSSIAFIASSKIT-NEENYLLQKIAR-LLGTNNIDNCARLCHESSVHALKLTLGAGIQT 152
gi 182628291  79 SWDEALNYVAERLSaikeKYGPDAIQTTGSSRGTgNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMS 158
gi 497674834 330 SWDEAISYIAKRLKeikeRYGPDSIGFIASDKMS-NEEAYLLQKLARAIIGTNNVDNSARYCQSPATVGLWRTVGIGADS 408
gi 499215651 335 SWEEAIAHTAKEFRriqyQYGRTSIGGITSSRCT-NEETYLVQKLVRQGFRNNNVDTCARVCHSPTGYGLGQTYGTSAGT 413
gi 497675026  74 TWDEAISDIASKLKeirsKYGSEAIAFYGGCQNT-LEEGYSFMKLARA-LGTNNVDSCARVCHEPSAMALKELVGIGASS 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IV2_X       159 NAINEIDNTDLVFVFGYNPADSHPIVANHVINAKR-NGAKIIVCDPRKIETAR----IADMHIALKNGSNIALLNAMGHV 233
gi 119886    151 NSYASFEDADLIFSIGANSLEAHPLVGRKLMRAKM-NGAYFIVADPRYTPTAK----QADQYIPFKTGTDVALMNAMMNV 225
gi 18893655  153 NPYSDLEKFKALMIWGYNPAETHPVVMQYIMNAKK-NGAKIIVVDVRETTTMK----FGDYKVIIRPGTDITLANAIMNV 227
gi 182628291 159 NAINEIDNTDLVFVFGYNPADSHPIVANHVINAKR-NGAKIIVCDPRKIETAR----IADMHIALKNGSNIALLNAMGHV 233
gi 497674834 409 GTIRDIENANLIVIVGHNTTESHPVIGSKVKRAKKiNGSKIVVIDVRKHEIAE----KADLFIKPKPGTDAAVLAGVAKY 484
gi 499215651 414 QDFDSVEFTDVAVVIGANPVSAHPVFASRLKKRLR-QGAKLIVLDPRRTEMVKsahiEADYHLPLKPGTNVAVLTSLAHV 492
gi 497675026 152 VTVSEILNARNIVISGESVTDSHPVLSQYLVEAKR-KGVKIVVIDPRMTGTAR----IADLFLQISSGTDIYLYNAVANY 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IV2_X       234 IIEENLYDKAFVASRT--EGFEEYRKIVEg--YTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETV 309
gi 119886    226 IISEGLEDKEFIEKRT--KNYEELKEVVSk--YTPEMAEEITQVPADVIRDIAIKYAKADKAAIVYSLGITEHSHGVDNV 301
gi 18893655  228 IIENRWYNKDFIEKRT--VGFSEIRMGVKk--YTPEYAEKITGVPARLIKEIAEAFAKAGSGAILWGMGVTQQIAGVENV 303
gi 182628291 234 IIEENLYDKAFVASRT--EGFEEYRKIVEg--YTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETV 309
gi 497674834 485 LIDQGWIDKEFIDKRV--NGFEEFKESIKg--FTLDYVEDITGVPRDQIIKLAEMIHNANSVAVLWGMGVTQHLGGADTS 560
gi 499215651 493 IVTEGLFDEAFIRERCdwTEFQDWASFVAlpeNSPETVGKLSGVDPDLIRGAARLYAKGGNGAIYYGLGVTEHSQGSTTV 572
gi 497675026 227 LISNGLYDSKFVKERV--ENFDEFREIVKs--YTIEEAERITSVSKDKIIEFARIIANKPT-ILSWGLGLTQ-SSGVNAV 300
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IV2_X       310 RSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHR 389
gi 119886    302 MQTANLAMLTGNIGRLGTGVNPLRGQNNVQGACDMGALPTDYPGYRKVADQEVMEDVTCTWGCSDLGCEPGLKIPEMIDA 381
gi 18893655  304 LALINIALLLGYFGEKGG-LYPMRGQNNVQGAAYMGTLSEFLPGYVPLSDSEFRKKVAKLWGVEDLPTERGLYLTEYWDA 382
gi 182628291 310 RSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHR 389
gi 497674834 561 TIISDLLLITGNYGKPGSGAFPMRGHNNVQGVSDFGCLPNYLPGYQKLEDENVIAKFEEAWG-VKLNRNPGLQIPQMIEG 639
gi 499215651 573 MAIANLAMATGNIGRPGVGVNPLRGQNNVQGSCDMGSFPHELPGYRHISGEAVRDIYESLWG-VKLDDEPGLRIPNMLDA 651
gi 497675026 301 KAYINLALLTGNVGINGGGLLVYRGQTNVQGSGDLIKPDVFPNG--PMN-EENAKELSKIWGFVP-PIKKGLSITEAF-- 374
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IV2_X       390 AAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAV 469
gi 119886    382 AAKGDLKVLYITGEDPVISDPDTHHVEEALNNLDFFVVQDIFMTDTAEFADVVLPAACWAEQEGTFTNGERRVQLIRKAV 461
gi 18893655  383 ILNGDLKVLYIVGENPAISDANVLKVRKALTKLELLVVQDIFLTRTARYAHYVLPAAAFCEKEGSYMNSERRIQWSHKAC 462
gi 182628291 390 AAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAV 469
gi 497674834 640 VLEGKIHALYIVGEDTVMVDCGTPLTRQALEKVDFLVVQDMFITETAKLADVILPAAASLEKDGTFVNTERRIQRFYKAM 719
gi 499215651 652 AVDGSFKGIYIQGEDILQSDPDTKHVAGGLAAMECVVVHDLFLNETANYAHVFLPGSTFLEKDGTFTNAERRINMVRKVL 731
gi 497675026 375 LRDSNVKALFLMNYNPAFSLPNRYKVIKFLKSLELLVVMDPFMTETAKYAHYVLPTPLWAEKEGSVTNLDRTVKWRFKVV 454
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IV2_X       470 EPKWDLKTDWQIISEIATRMGYP---MHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRdtSDADQgTSYLFKE 546
gi 119886    462 DAPGESKYDWEIFCDLAKKMGADpemFTYESAQDIFEEVRTVTPQYAGMNRERLDRPEALHWPCP--SEDHPgTAMMHIE 539
gi 18893655  463 EPLGESKPDWEILTMLANALGLRg--FN---YKRVEEITEEYFKLFPELENRSVEELKNSEGIVIp----SP---RLYTD 530
gi 182628291 470 EPKWDLKTDWQIISEIATRMGYP---MHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRdtSDADQgTSYLFKE 546
gi 497674834 720 EPIGDSKPDWEIIQMVANALGAN---WSYNHPAEIMNEIAKLGPIFAGVNYSRLEGFNSLLWPVN--EDGSD-TPLLYTN 793
gi 499215651 732 EPKAR-YADWEATQELARAIGLD---WNYTHPSQIMDEIAQTTPSFANVSFELLDRVGSVQWPCNe-KAPLG-TPIMHID 805
gi 497675026 455 DPPGEVRSELWIIKRIAEKLGLT---GFHDDPKLVFKEIKEVAKLYSNLTLDELMDYSVDSRYPDh-E------SSLYKD 524
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IV2_X       547 KFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCrSMTGNCAALAALADEPgYAQINTEDAKRLGIEDEALV 626
gi 119886    540 KFAHPDGLGIFMPLEEQGPMETPDDEYPLILTTTRLLFHYHA-AMTRRAATLDREVPTG-YVEINTEDAAELGIANKEKV 617
gi 18893655  531 RFLTPGGRARFISVEQIMPWEEPNGEYPLILTTVRLITHYNTgEMTMRSPSLTKMIGEP-FVLISREDAQEYGIKEGDYV 609
gi 182628291 547 KFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCrSMTGNCAALAALADEPgYAQINTEDAKRLGIEDEALV 626
gi 497674834 794 AFATKDGKAILYPLSWK-PPELKDEVHKVTVNTGRVLEHFHVgNMTRRVEGLRRKVPET-FVEVSKELASKYSIKNGDLV 871
gi 499215651 806 GFVR--GKGKFIRTEYVATDERTGPRFPLLLTTGRILSQYNVgAQTRRTDNVMWHSED--RLEIHPHDAENRGLRDGDWV 881
gi 497675026 525 RFMTPSGKAKFG----LVRYNEISGDS-YILITGRVVTRYNSdELIKRVPGYRNFSSD---LLINPEDATKLNIKDGDMV 596
                        650       660       670       680       690       700
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
2IV2_X       627 WVHSRK-GKIITRAQVSDRPNKGAIYMTYQWWIGA--CNELV-TENLSPITKTPEYKYCAVRV 685
gi 119886    618 KVKSRR-GEIEIAARVTDDIVKGIVNIPMHFRECS--ANILTnAAAIDPKSGMPEYKACAVAI 677
gi 18893655  610 VVETRR-GNLTLKAKISNIQRG---VIAIPFHFEA---NVLT--NDALNKAGTPELKFSAARI 663
gi 182628291 627 WVHSRK-GKIITRAQVSDRPNKGAIYMTYQWWIGA--CNELV-TENLSPITKTPEYKYCAVRV 685
gi 497674834 872 LVKSKFgGEIKARAIVSDRVEGEEIFIPLYASDPSkgVNNLT-GLVIDKASGTPGYKDTPVVI 933
gi 499215651 882 RLTSRS-GETTLRALITDRVSPGVVYTTFHHPDTQ--ANVIT-TDFSDWATNCPEYKVTAVQV 940
gi 497675026 597 KVVSKC-GMAVMKAKLTNEVKVGHTFAYMHDYY----VNNVV-CDDLDDISKTPRYKITFVKI 653
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap