Conserved Protein Domain Family
PYST-B

?
TIGR01597: PYST-B 
Plasmodium yoelii subtelomeric family PYST-B
This model represents a paralogous family of Plasmodium yoelii genes preferentially located in the subtelomeric regions of the chromosomes. There are no obvious homologs to these genes in any other organism.
Statistics
?
PSSM-Id: 130658
View PSSM: TIGR01597
Aligned: 3 rows
Threshold Bit Score: 301.429
Threshold Setting Gi: 83317865
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82595719   1 MRVSILRFVFFSIIICFFEYAQNELYLVNERSIFLERNIIKFRSNRILADVDNQFDLNDFYESTLSLANQFNEYNADDKE 80
gi 83032932   1 MRFNILKYVFFSIIICSFEYAKNELYLVNERTICFERNIKIFRNNRTLADADNQFDLNEFYQSTLSLASQFNDCNDGNKE 80
gi 83317865   1 MRVSILKFVLFSIFICYFEYVKNELYLVNERNIYHERNITNFRNNRILADADNQFDLNEFYQSTLSLANQFNDDNDDDEE 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82595719  81 MTFLRNAIDSHIKKHKESNTLPDLNNVDKKTKKTILKLQRELEEIKKELANKSNSELEIQSIHDKRIIKKDENNSVS--- 157
gi 83032932  81 IAHLRNIIDSYIKKHKERSTILNLKNVDSKAKKLINKFRKELEELTKELDNEMNDELTIQPTHDKIIIKKDENSSVS--- 157
gi 83317865  81 IKYLQNIIDSHVKKHKENNTLPDLNSLDKKTKKLIDELQKEIEETKKELDNIRNNKLAIEPIQ---------NNPVSeee 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82595719 158 -GNEDFNQLENEVNSLEEEFKQF---------DLSGVDN--YKYKRKEDKLYKGLKLRLILMFFFSFATMVsGCVNLPLA 225
gi 83032932 158 -EHEELKQLENYKNSSVSEHEEFkqlendennEIASSSNnkLKIRRKLKKEVIKCIVTCLTFIVIVCSILI-GPVYLLAL 235
gi 83317865 152 eEEEDFKQLKNERNIVGNEHYEV---------DPKIEDE--SKTKRELTKLTKKLMVRGVVLTLLVLSLLVpGLIYFVFV 220
                       250       260       270
                ....*....|....*....|....*....|...
gi 82595719 226 IISLAISFESFIKSfqyIKLLYlhfFMFYRIMK 258
gi 83032932 236 FIPSLISIYWSFWR---VDKYR---TKLKNISK 262
gi 83317865 221 IMNVILSIGILIECckyVKLCFkeyksykkkkk 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap