Conserved Protein Domain Family
phage_tail_L

?
TIGR01600: phage_tail_L 
lambda-like phage minor tail protein L
This model detects members of the family of phage lambda minor tail protein L. This model was built as a fragment model to allow detection of fragmentary sequences, as might be found in cryptic prophage regions. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130661
View PSSM: TIGR01600
Aligned: 3 rows
Threshold Bit Score: 392.382
Threshold Setting Gi: 15801579
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17428710    6 DIQRLEPGALVELFELDATGVGG-DVLRFHG--YAQVGSIWWKGSEYSPWPIEATGFARTGQGQQPAPRLAVGNVDGAIS 82
gi 3883046    17 DIQSLSPSALIELFELDMSNTTSgGKLFFHAgtNELMEPVVWQGVSYEPWPIKASGFDKTGQGTLPRPKIQVSNFAGTVS 96
gi 447073849  11 ESVKSEQSPRVVLWEIDLTAQGG-ERYFFCNelNEKGEAVTWQGRQYQAYPIDGSGFEMNGKGSSARPSLTVSNLFGLVT 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17428710   83 ALCLYTDDLVGAKVRRRRTLGRFLDARNFPEGNPEADPTEELPMEEWFIEQKTAETNETVEFELSSALDFNGVQLPRRQI 162
gi 3883046    97 AEVQANDYLVGCRIIRKMTLARFLDAANFKDGNPTADPNQHFPDEMWFVEQKTLETHEVVEFELSSVFDLMGVQLPYRQI 176
gi 447073849  90 GMAEDLQSLVGATVVRRRVYARFLDAVNFVAGNPEADPEQEL-TDRWVVEQMSSLTAMTASFVLATPTETDGALFPGRIM 168
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 17428710  163 VANVCGWltVggYRGPECGYTGaAMFDRDDNAVSDPSLDKCGGRLSSCKCR--FGANELLPFGGFPAADLI 231
gi 3883046   177 IKNTCPW--K--YRGPECGYTG-PYFDKNNQQTTMSGADYCTKRYDSCNARrnYFANGVIHFGGFIGATRY 242
gi 447073849 169 LANTCMWd----YRGDECGYNGpAVADEFDNPTTDIRKDRCSKCMRGCEMR-----GMVANFGGFLSINKL 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap