Conserved Protein Domain Family
PY-rept-46

?
TIGR01602: PY-rept-46 
Plasmodium yoelii repeat of length 46
This repeat is found in only 2 genes in Plasmodium yoelii, in each of these genes it is repeated 9 times. It is found in no other organism.
Statistics
?
PSSM-Id: 130663
View PSSM: TIGR01602
Aligned: 2 rows
Threshold Bit Score: 40.5272
Threshold Setting Gi: 82794710
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
gi 82794710  10 KSKRSRFPTMFKKDKKDKEDKDANGSQESLNVDKSLESLNDDSKSQ 55
gi 82794710  56 KSKRSRFPTMFKRDKKDKEDKDVNGSQESLNIDKSLESLNDDGDDN 101
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap