Conserved Protein Domain Family
tail_tube

?
TIGR01611: tail_tube 
phage contractile tail tube protein, P2 family
The tails of some phage are contractile. This model represents the tail tube, or tail core, protein of the contractile tail of phage P2, and homologous proteins from additional phage. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130672
View PSSM: TIGR01611
Aligned: 4 rows
Threshold Bit Score: 274.002
Threshold Setting Gi: 16502715
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16502715    4 IEINRITNANIYLDGTNLLGRAEEVKLPDVSMIMQEHKALGMVGKVELPAGFDKLEGEIKWNSfYRDAMLSAANPYKSLA 83
gi 17428935    2 ALPRILKHFNVFADGVVHTGECEEINLPKLARKLEEYRAGGMNGAIQIDMGNEKLELETTYGG-PMREILKQYGTTAVDG 80
gi 499195712   3 APRHLLKHLNLFIDGKGYAGQVEDINLPKLTLKTEEFRGGGMLAPVELTMGMEKLETDVSLIC-YSSDALLLFGVTEGKQ 81
gi 489175649   1 MIPQTLTNTNLFIDGVSFAGDVPSLTLPKLAVKTEQYRAGGMDAPVSIDMGLEAMEAKFSTNG-ARREALNFFGLADQSA 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16502715   84 LQCRsSVQRYSSQGLIDEIPLVTFLTIMFKKNPLGTFKQHENAEFSSSFTCTYIRQVLDGEELLQLDYLANIFRVGGVDQ 163
gi 17428935   81 AMIR-FAGAYQHEDTKEVDAVEIVVRGRHTEIDFGTAKAGAKAPFKVKSSLTYYKMTVNGEVWCELDFVNFVEVVFGEDR 159
gi 499195712  82 VNCT-VRGFLESFD-GTTTTLAIHLRGKVKEIDRGTWKPADKSTLKLALALSYYKEVHNATVIHEIDVENMIFQQNGIDL 159
gi 489175649  80 FNGV-FRGSFKGQK-GASVPVVATLRGLLKEVDPGDWKAGEKAEFKYAVAVSYYKLEVDGREVYEIDPVNGVRAINGVDQ 157
                        170
                 ....*....|
gi 16502715  164 LTDYRINIGG 173
gi 17428935  160 LAAQRRAIGL 169
gi 499195712 160 LAPARNALGL 169
gi 489175649 158 LAGMRNDLGL 167
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap