Conserved Protein Domain Family
RluA-like

?
TIGR01621: RluA-like 
pseudouridine synthase Rlu family protein, TIGR01621
This model represents a clade of sequences within the pseudouridine synthase superfamily (pfam00849). The superfamily includes E. coli proteins: RluA, RluB, RluC, RluD, and RsuA. The sequences modeled here are most closely related to RluA. Neisseria, among those species hitting this model, does not appear to have an RluA homolog. It is presumed that these sequences function as pseudouridine synthases, although perhaps with different specificity. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 130682
View PSSM: TIGR01621
Aligned: 3 rows
Threshold Bit Score: 402.356
Threshold Setting Gi: 1175071
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175071     2 EIEVVYQHSDFIIINKSEGISVHKDQEEQGLTELVAKQLNVPKVWLVHRLDKVTSGLLILALNAESAAEFSRLFSEHKIH 81
gi 446381831   1 MFDILFTHPDFLLINKHPNVSVHKDDGDTMLLQEVATQTGDGQLYLVHRLDKMTSGILLLARNATAASELSQGFAKRKVE 80
gi 504394564 182 MLEILFRHQDFVAINKPGGISVHQDSGETGLARTLAIQLGVERVWLLHRLDKQTSGILLFALNKESASALSGQFAGKSIK 261
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175071    82 KTYLALSNQKPKKKQGLIIGDMKKAREGAWKLCQTKDNPAITRFESVSCEPNLRLFILKPQTGKTHQLRVAMKSLGSPIL 161
gi 446381831  81 KFYLAIGSKKPKKKQGLICGDMERSRRSSWKLVNSQENPAITQFFSAAAATGERLFLCKPHTGKTHQIRVALKSIGSAIV 160
gi 504394564 262 KTYLALSDRKPSKKQGWIKGGMEKSRCGMWKLTRNTENIAVTRFHSISIAEKLRLFILEPHTGKTHQLRVAMKSLGSPIL 341
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 1175071   162 GDGLYGKnTEKIDRTYLHATQLEFDYLNNFISVTCLPSQG----QFWIKPTVFEQIQVYLTK 219
gi 446381831 161 GDPIYNT-ADESDRGYLHAFALRFTYQGEVYQWLCDPRQFshlgQKWHEEAVNQGIENWLSP 221
gi 504394564 342 GDSLYGG-T-ESETMFLYAWKIQFDYQNRQIEIVAPLKN------EWQTENIHRALEEFCME 395
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap