Conserved Protein Domain Family
put_zinc_LRP1

?
TIGR01623: put_zinc_LRP1 
putative zinc finger domain, LRP1 type
This model represents a putative zinc finger domain found in plants. Arabidopsis thaliana has at least 10 distinct members. Proteins containing this domain, including LRP1, generally share the same size, about 300 amino acids, and architecture. This 43-residue domain, and a more C-terminal companion domain of similar size, appear as tightly conserved islands of sequence similarity. The remainder consists largely of low-complexity sequence. Several animal proteins have regions with matching patterns of Cys, Gly, and His residues. These are not included in the model but score between trusted and noise cutoffs.
Statistics
?
PSSM-Id: 130684
View PSSM: TIGR01623
Aligned: 4 rows
Threshold Bit Score: 82.2549
Threshold Setting Gi: 7288021
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40
               ....*....|....*....|....*....|....*....|...
gi 882341  111 TCQDCGNQAKKECKQRRCRTCCKSRGFDCSTHVKSTWVSAARR 153
gi 4567272   8 KCEDCGNQAKKDCVYMRCRTCCKSKAFHCQTHIKSTWVPAYRR 50
gi 4874291  71 SCQECGNQAKKGCTHGRCRTCCKSNGLHCPTHVRSTWIPIAKR 113
gi 7288021  40 VCRDCGNRAKKECLFERCRTCCKSRGYNCVTHVKSTWIPSSAT 82
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap