Conserved Protein Domain Family
ytfJ_HI0045

?
TIGR01626: ytfJ_HI0045 
conserved hypothetical protein YtfJ-family, TIGR01626
This model represents sequences from gamma proteobacteria that are related to the E. coli protein, YtfJ.
Statistics
?
PSSM-Id: 130687
View PSSM: TIGR01626
Aligned: 3 rows
Threshold Bit Score: 318
Threshold Setting Gi: 1176921
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176921     1 MKKQILALVCGVIFSSSTWAHNLQLEQSLPSVKVSEYGEIVLSGKDTVFQPWGSAELAGKVRVVHHLAGRTAAKEXNQSM 80
gi 486163624  21 MTLRKILAMSCLLLPIMACAHNLEVNQRVPPVGIADRGELTLNKDEFSYKNWNSAQLAGKVRVLLHIAGRTSAKEKNATL 100
gi 446715059   1 MKNKTLIALLLACSPTLAFAHNLTVGSPVPAVGVEKHGEIVLQDNNINYQKWRSADLLGKVRVIQAIAGRSSSKEMNAPL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1176921    81 IDVIKASHFNPVKYQTTTIINADDAIVGTGMFVKNGAKKGKQENPHSQVVLDDKSAVKNAWGLNSKDSAIIVLDKTGKVK 160
gi 486163624 101 IEAIKSAKLPHDRYQTTTIVNTDDAIPGSGMFVRSSIESNKKLYPWSQFIVDSNGVARNAWQLKEEGSAVIVLDKDGRVQ 180
gi 446715059  81 MAAITAAKFPAESYQTTTIINQDDAIWGTSSFVKSSAQDSKKEFPWSSMVLDEFGLVAQAWQLQAESSAIIVQDKQGNVL 160
                        170       180
                 ....*....|....*....|....
gi 1176921   161 FVKEGKLSDSDIQTVISLVNGLTK 184
gi 486163624 181 WVKDGALTQQEVQQVVDLLHKLLS 204
gi 446715059 161 FVKEGALNEADIQTVLGLIQQNL- 183
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap