Conserved Protein Domain Family
A_thal_3515

?
TIGR01627: A_thal_3515 
uncharacterized plant-specific domain TIGR01627
This model represents an uncharacterized domain found in both Arabidopsis thaliana (at least 10 copies) and Oryza sativa. Most member proteins have only a short stretch of sequence N-terminal to this domain, but one has a long N-terminal extension that includes a protein kinase domain (pfam00069).
Statistics
?
PSSM-Id: 130688
View PSSM: TIGR01627
Aligned: 3 rows
Threshold Bit Score: 388.108
Threshold Setting Gi: 9665091
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6523033  82 SNLPTSAINALLHYASrSNDSFHMSYGEMKSISDVLRRCAPpCNLLVFGLTHETLLWKSLNHNGRTVFIEEN--RYYAAY 159
gi 9665091  67 TKMPLSLSDALVHYVT-SNVTPQQTFDEVSVSKRVLDKKSP-CNFLVFGLGHDSLMWASLNHGGRTLFIEED--QAWIAI 142
gi 4455234  79 TTFRLSPADSSQQLRA-NEGPTALMEKELKLLSDTVTRRSP-CNILVFGFAPQYLMLSSINTRGITVILEDEpaKIMIPK 156
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6523033 160 FEEIHPEIDVFDVQYT-TKAHEAGELVTAAKEaAgnECRPVQ---NLlFSDCKLGLNDLPNHVYDVDWDVIFVDGPRGDA 235
gi 9665091 143 VTKKFPNLESYHVVYD-TKVKDSDKLMELGRS-E--ECRSVSd--PR-NSKCDLALKDFPADFYETKWDLIMVDAPTGYH 215
gi 4455234 157 AEVNPNNTRIYSLKYHqMEVRNAYNLLQHARAnP--ACAPNMnnqHQgSSDCKLELRDLPQQVHNTKWDVIVVDGPRGDD 234
                      170       180       190       200       210       220       230
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 6523033 236 HEGPGRMSSIFTAAVLARSKKGGtPkTHVFVHDYYRDVERLCGDEFLCRENLVESNDLLAHYVLDKMDknSTK---FC 310
gi 9665091 216 EEAPGRMSAIYTAGLLARNREDG-E-TDVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHR--ARAgrpFC 289
gi 4455234 235 LETPGRMGSIYTAAVLARKGSSNsT-TDVFVHDVHRTAEKWLSWEFLCQENLVSAKGTFWKFRIKRQSnaSR----FC 307
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap