Conserved Protein Domain Family
tail_P2_I

?
TIGR01634: tail_P2_I 
phage tail protein, P2 protein I family
This model represents the family of phage P2 protein I and related tail proteins from a number of temperate phage of Gram-negative bacteria. This model is built as a fragment model and identifies some phage tail proteins with strong but local similarity to members of the seed alignment. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130695
View PSSM: TIGR01634
Aligned: 4 rows
Threshold Bit Score: 233.23
Threshold Setting Gi: 4063792
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3337270     7 LPVGSSPLEVAAARACADIENTPVPLRRLWSPDTCPANLLPWLAWAFSVDRWDENWPEKTKRDVIRSAYFTHCHKGTIGA 86
gi 4063792     5 LPRNATELERLAAEALAQIERVPIPLRQLWNPSTCPVALLPYLAWAFSVDRWDSTWPERVKRQVIRDAYLVHSHKGTLSA 84
gi 499195709   9 LPPTATPLMRTLEQVMARLADIPIPFKQLWDPHTCPEPLLPWLAWSLSVDTWRSTWPVHIKRARIAAAIEIQRCKGSVKS 88
gi 492707541   5 LPPNATPIERALAAVTARLEAIPLPYPDLWNPDTCPAGHLPWLAWTLSVDDWKADWSDAVKRSRLRSAMAIQRRKGTANS 84
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 3337270    87 VRRVIEPLGYIINVTEWWETG--DPAGTFRLDIGVLESGITEEMYLEMERLIADAKPAS 143
gi 4063792    85 LRRVVEPVGSLTDILEWWQQTpaGVPGTFEITVDVSDNGLDEETVLELERLLDDVRPVS 143
gi 499195709  89 VRDVVRSFGGDVLITEWWQQNppAAPHTFTLLLTLSGQGGSQTTAEFVADVITEVIRTK 147
gi 492707541  85 VRMVVESFGGAVAIREWWQTEprGQPHTFELTLTLTGTDGQTATSRFVNEVIAEVERTK 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap