Conserved Protein Domain Family
phage_rinA

?
TIGR01636: phage_rinA 
phage transcriptional activator, RinA family
This model represents a family of phage proteins, including RinA, a transcriptional activator in staphylococcal phage phi 11. This family shows similarity to ArpU, a phage-related putative autolysin regulator, and to some sporulation-specific sigma factors. [Mobile and extrachromosomal element functions, Prophage functions, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130697
View PSSM: TIGR01636
Aligned: 3 rows
Threshold Bit Score: 183.566
Threshold Setting Gi: 16801645
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 417648      8 LKLSTVRKLEDELCDYPNYHKQLEDLRSEIMTP---WIPTDTNIGGEFVPSNTSKTEMAVTNYLCSIRRGKILEFKSAIE 84
gi 488309986   1 MRTSTFNYIKDILADFYKTEEYIRQREEELRHP---YQEADLNAGIRGQGLHSVVTERMAITIAMDRRLWNLERNRDIIK 77
gi 489827893   5 LRKAQYKLIEDELKFYHSTKKELMEKEVNVTLGawhREYIDENQGGGSAGNISNEVEDRVMLLQMDKEISRLKNIINAIE 84
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 417648     85 RIINSSSRKEREFIQEYYFNKK---ELVKVCVDIHISDRTAHRIKRKIISRLAEELGE 139
gi 488309986  78 NCLAEADEQTRVIIEELYMKKRpslTLIGLAQQLFISKSQAYKLRNHFFEAVADELGM 135
gi 489827893  85 SVLNRLNDEDKQLIQFRYWDRSk-pTWVWIASKLNMDESTARRRNKTIILSIAERLGY 141
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap