4JLE


Conserved Protein Domain Family
P_fal_TIGR01639

?
TIGR01639: P_fal_TIGR01639 
Click on image for an interactive view with Cn3D
Plasmodium falciparum uncharacterized domain TIGR01639
This model represents a conserved sequence region of about 60 amino acids found in over 40 predicted proteins of Plasmodium falciparum. It is not found elsewhere, including closely related species such as Plasmodium yoelii. No member of this family is characterized.
Statistics
?
PSSM-Id: 130700
View PSSM: TIGR01639
Aligned: 15 rows
Threshold Bit Score: 55.724
Threshold Setting Gi: 258597971
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
4JLE_A        11 INKCDM-KKYTAEEINEMINSSNEFINRND--MNIIFSYVHESEREKFKKVEENIFKFIQSI 69
gi 641582370 732 KKFFDLnHEITEEDLTEMVRSLDNIPSIND--ILHIWWQLREVERHKFAMMQYRLMKYIGHL 791
gi 574983175 152 QDYNDVnKKFTKEQMKNLVNSLDEIPPRND--MEKIWNHAVKTANSGTSRIKKKLKEYEQKY 211
gi 574988086 151 DKYYDLtKQWSDEKIEEIINSLLDIPNKFD--VLTIWMQVRGSEKLKMHNMLYGLRLLYKEL 210
gi 583213466  98 VDYNDLsRNLSREELNAVLRGLNDDTPRND--LISIWNHVVRINRDGMVDIINSILLYVNNF 157
gi 574972030 164 YEYSELaDSMTDEEIDKEVDKLMEYTNNNKekVYSLWWQIMRNERVKYVMIMKNLYNFFLKL 225
gi 258549061 147 LIFGDTsPDLSESEFNEFINNLDDYVNKNE--MYIIWNYVNSKEKFKYLNMQQNIKSYCENL 206
gi 579113409 146 KKCTDLsAFESKEDIYILLCSLSEIPKKCE--ILGIWYQAIYIARN-SSKMQEHLKEYMCCH 204
gi 574999522  10 HNNNFIsKQLTKEELYDLLYTLVEVPERKI--LLLLWNQTIGLYNEQLEDLLKEIYNFLPNR 69
gi 583211546 172 IKLEEIsLPLSKLELSHIISRLNKDVPKEY--LMNLWLQAFAVSND-LVDIVNLLNEYIQYY 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap