Conserved Protein Domain Family
CobT

?
TIGR01651: CobT 
cobaltochelatase, CobT subunit
This model describes Pseudomonas denitrificans CobT gene product, which is a cobalt chelatase subunit that functions in cobalamin biosynthesis. Cobalamin (vitamin B12) can be synthesized via several pathways, including an aerobic pathway (found in Pseudomonas denitrificans) and an anaerobic pathway (found in P. shermanii and Salmonella typhimurium). These pathways differ in the point of cobalt insertion during corrin ring formation. There are apparently a number of variations on these two pathways, where the major differences seem to be concerned with the process of ring contraction. Confusion regarding the functions of enzymes found in the aerobic vs. anaerobic pathways has arisen because nonhomologous genes in these different pathways were given the same gene symbols. Thus, cobT in the aerobic pathway (P. denitrificans) is not a homolog of cobT in the anaerobic pathway (S. typhimurium). It should be noted that E. coli synthesizes cobalamin only when it is supplied with the precursor cobinamide, which is a complex intermediate. Additionally, all E. coli cobalamin synthesis genes (cobU, cobS and cobT) were named after their Salmonella typhimurium homologs which function in the anaerobic cobalamin synthesis pathway. This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobT gene product, which is a cobalt chelatase subunit, with a MW ~70 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobS (TIGR01650) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobT gene product, the P. denitrificans gene symbol is not used in the name of this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 130712
View PSSM: TIGR01651
Aligned: 3 rows
Threshold Bit Score: 1019.87
Threshold Setting Gi: 16124925
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 231834     17 EPFKRALSGCIRSIAGDAEVEVAFANERPGMTGERIRLPELSKRPTLQELAVTRGLGDSMALRKACTHARIQRTMSPQGA 96
gi 499214233  19 DSFKRAVTVCMRAIAGDKDMEVGFAKDRPALAGSRARLPELPKKASKTDIAITRGLGDSMALKRACHDARIHSKLAPEGK 98
gi 499221018  10 EPFKRALAHAARSLAETPDLEVVFSGDGPQLLGNRAVLPHPPRDLSSREAARIRGLADQMALRLAHHDPLAHARARPSSP 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 231834     97 DARAIFDAVEQARVEAIGSLRMAGVAKNLNVMLEEKYAKANFA--TIERQADAPLGEAVALLVREKLTGQKPPASAGKVL 174
gi 499214233  99 AARAIYDAVEQARVEAIGSRAMQGVADNIGSMLEDKYAKANLV--DVKDKADAPIEEALALMVREKLTGRAVPKSGERLV 176
gi 499221018  90 DGQAAFESIEQARLEAIGANALGGVRANLTAALEARLEKQGLTraVATDRQSAPMAEILGLMVRERLTGDAPPHGAKALV 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 231834    175 DLWREFIEGKAAGDIEHLSSTINNQQAFARVVRDMLTSMEVAEKYGDDdnEPDEQESETDEDQPRSQEQDENASDEEAGD 254
gi 499214233 177 ELWRPWVEEKAKADLDGLSAKLDDQQAFARVVREMLASMEMAEELGDD--QETEDSEDNDDNQPQGDEQSEEGGEEDSGS 254
gi 499221018 170 DILRNDIEARAGKDLDRLAAAIDDQAAFARVTREILRDLDLSEEMADA--TESADEEDGEDDAPTENSDEDQGEGEGEQQ 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 231834    255 DAAPADENQAAEEQMEEGEMDGAEISDDDLQDEGDEDSETPGEVKRPNQPFADFN--EKVDYAVFTREFDETIASEELCD 332
gi 499214233 255 EQSQSEDAEASADDEQSSETEASDATADDLSDDDDADAETPGEARRNDNPFTNLP--KEIDYKVFTSAFDETVGAEELCE 332
gi 499221018 248 EGSAPQESEATDRESESGDEEMVQSDQEGEPEES-DESPEMGDGAKPARPDTSTGqgGEPQYKIFTTAHDEIVDAEDLCD 326
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 231834    333 EAELDRLRAFLDKQLAHLQGAVGRLANRLQRRLMAQQNRSWEFDLEEGYLDSARLQRIIIDPMQPLSFKREKDTNFRDTV 412
gi 499214233 333 EEELDRLRAFLDKQLANLSGVVGRLANRLQRRLMAQQNRSWDFDLEEGYLDPARLVRVVIDPMQPLSFKQERDTKFRDTV 412
gi 499221018 327 AEELTRLRAYLDQQLTALSSVVSRLANKLQRRLLAQQNRSWTFDLEEGMLDVARLTRVIIDPTAPLSFKQEEDQEFRDTV 406
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 231834    413 VTLLIDNSGSMRGRPITVAATCADILARTLERCGVKVEILGFTTKAWKGGQSREKWLAGGKPQAPGRLNDLRHIVYKSAD 492
gi 499214233 413 VTLVLDNSGSMRGRPITVAATCADILARTLERCGVSVEILGFTTRAWKGGQAREKWLKDGKPPNPGRLNDLRHIIYKSAD 492
gi 499221018 407 VTLLIDNSGSMRGRPIMVAAICADILARTLERCGVKTEVLGFTTRAWKGGTSRDEWIKAGKPAAPGRLNDLRHIIYKAAD 486
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 231834    493 APWRRARRNLGLMMREGLLKENIDGEALIWAHERLMARREQRRILMMISDGAPVDDSTLSVNPGNYLERHLRAVIEQIET 572
gi 499214233 493 HPWRRARRNLGLMMREGLLKENIDGEALLWAHNRLIARPEQRKILMMISDGAPVDDSTLSVNPGNYLERHLRAVIELIET 572
gi 499221018 487 APWRRARKNLGLMMREGLLKENIDGEALMWAHQRIIARPEQRRILMVISDGAPVDDSTLSVNSGHYLERHLRQVITEIEG 566
                        570       580       590       600
                 ....*....|....*....|....*....|....*....|....*.
gi 231834    573 RSPVELLAIGIGHDVTRYYRRAVTIVDADELAGAMTEQLAALFEDE 618
gi 499214233 573 RSPVELLAIGIGHDVTRYYRRAVTIVDAEELAGAMTEQLASLFAEE 618
gi 499221018 567 KSPVELIAIGIGHDVTRYYRRAVTIVDVEQLGGVLVEQLAALFEEE 612
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap