Conserved Protein Domain Family
GLDHase

?
TIGR01676: GLDHase 
galactonolactone dehydrogenase
This model represents L-Galactono-gamma-lactone dehydrogenase (EC 1.3.2.3). This enzyme catalyzes the final step in ascorbic acid biosynthesis in higher plants. This protein is homologous to ascorbic acid biosynthesis enzymes of other species: L-gulono-gamma-lactone oxidase in rat and L-galactono-gamma-lactone oxidase in yeast. All three covalently bind the cofactor FAD.
Statistics
?
PSSM-Id: 130737
View PSSM: TIGR01676
Aligned: 2 rows
Threshold Bit Score: 1155.2
Threshold Setting Gi: 20279572
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6519872   47 ESELRKYIGYTLLLLGCGAATYYSFPFPENAKHKKAQLFRYAPLPDDLHTVSNWSGTHEVQTRTFLQPEAIEELEGIVKT 126
gi 20279572  50 DSELRKYLGYGALVIFCGAATYYSFPFPENAKHKKAQIFRYAPLPEDLHTVSNWSGTHEVLTRVFHQPEDLEQLEQVVKQ 129
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6519872  127 ANEKKQRIRPVGSGLSPNGIGLTRAGMVNLALMDMVLYVDEEKKTVTVQAGIRVQQLVDAIKEYGITLQNFASIREQQIG 206
gi 20279572 130 ANEKKARVRPVGSGLSPNGIGLSRLGMVNMALMDKVLEVDKEKKRVRVQAGIRVQQLVDGIKEYGLTLQNFASIREQQIG 209
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6519872  207 GIVQVGAHGTGAKLPPIDEQVISMKLVTPAKGTIEISKEKDPELFYLARCGLGGLGVVAEVTLQCVERQELVEHTFLSNM 286
gi 20279572 210 GIIQVGAHGTGAKLPPIDEQVIAMKLVTPAKGTIEISNDKDPELFFLARCGLGGLGVVAEVTLQCVERQELVEHTYISNM 289
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6519872  287 KDIKKNHKKFLSDNKHVKYLHIPYTDAVVVVTCNPISKSRGPPKHKPKYTTEEALQHVRVLYRESLKKYRgqvadsGSPE 366
gi 20279572 290 KDIKKNHKKLLADNKHVKYLYIPYTDAIVVVTCNPISKWRGPPKFKPKYTSEEAIQHVRDLYVESLKKYS------ASEE 363
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6519872  367 PEIDELSFTELRDKLLALDPLNKVHVIEINKAEVEFWRKSEGYRVGWSDEILGFDCGGHQWVSETCFPAGTLSKPSMKDL 446
gi 20279572 364 RDINEFSFTELRDKLLALDPLNKEHVMKVNQAEAEFWRKSEGYKVGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDI 443
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6519872  447 EYIEELMQLIEKESVPAPAPIEQRWTACSKSRMSPAYSSADDDIFSWVGIIMYLPTMDARQRRQITEEFFHYRHMTQAQL 526
gi 20279572 444 EYIEELKQLIEKENIPAPAPLEQRWTGRSKSPMSPASSTAEDDIFSWVGIIMYLPTSDARQRKEITEEFFHYRHLTQTLL 523
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 6519872  527 WDHYSAFEHWAKIEVPKDKEELAALQERLKKKFPVDAYNQARKELDPNRILSNNMLEKLFI 587
gi 20279572 524 WDKFSAFEHWAKIEVPKDKDELAALQARLRKRFPVDESNKARRALDPNKILSNNKLEKLFS 584
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap