Conserved Protein Domain Family
bact_FAD_ox

?
TIGR01679: bact_FAD_ox 
FAD-linked oxidoreductase
This model represents a family of bacterial oxidoreductases with covalently linked FAD, closely related to two different eukaryotic oxidases, L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae.
Statistics
?
PSSM-Id: 130740
View PSSM: TIGR01679
Aligned: 3 rows
Threshold Bit Score: 710.117
Threshold Setting Gi: 15608909
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499217896   8 WSNWSGFVTAEPRLIASPADAGELGDLVRTAPGP---VRVVGAGHSFTPLVKSQGTILSLEKLEGLVSHDpqKHQARVKA 84
gi 499221561  50 WRNWSGVQHAYPAARLAPKDEGELATALKVAQAP---IRPVGSGHSFTALAPTDGTLVSLDSMSGIVGWE--GDEAIVRA 124
gi 489503862   5 WSNWPGEQVCAPSAIVRPTSEAELADVIAQAAKRgerVRAVGSGHSFTDIACTDGVMIDMTGLQRVLDVDqpTGLVTVEG 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499217896  85 GTRLGPLMHILQGIGQGLPNMGDIDRQAIGGALGTATHGSGPTLGAYHTQLETVQIVDGLGKVRDFTRAGDQDMIHAIGV 164
gi 499221561 125 GTRLGALGPLLAEKGRALANLPDINKQSLGGALGTATHGTGIKIPAMHGDVTGLRLVTPSGKIIDADASNNPEIFQAARV 204
gi 489503862  85 GAKLRALGPQLAQRRLGLENQGDVDPQSITGATATATHGTGVRFQNLSARIVSLRLVTAGGEVLSLSEGDD---YLAARV 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499217896 165 ALGAFGVLSEVTLNNIATYRLRRRKWVLPIGDMLRDFEKMMTAHRSAEFYYIPFSGYAQFIASDFSTEATTT---RPTDD 241
gi 499221561 205 SMGALGVISQVRMRTSANRRLRRRVWLEPFEEAMAKADGRWAQHRNFEFYAVPFTGLAVNITHDETDDPAEA---RGPDQ 281
gi 489503862 162 SLGALGVISQVTLQTVPLFTLHRHDQRRSLAQTLERLDEFVDGNDHFEFFVFPYADKALTRTMHRSDEQPKPtpgWQRMV 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499217896 242 DEGSL-RTLRRLRTGLAWLPSLRRRLILGAVAKVPSEDYVQDWLNVYASDRQTKFNEMEYHLPFEEGPKALAEIIELTEK 320
gi 499221561 282 DVEFL-QALRGLRNLLGFATPLRKAAAKALLSSAKPESSVDEGWKLLSTERPVRFNEMEFHLPVENQLKALEEVMRTIET 360
gi 489503862 242 GENFEnGGLSLICQTGRRFPSVAPRLNRLMTNMMSSSTVQDRAYKVFATQRKVRFTEMEYAIPRENGREALQRVIDLVRR 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499217896 321 RFPEVYFPMEVRSVAPDKFWLSPFYNRPTCSIAIHHDAASDPLPFMQAAEPIFRRYGGRPHWGKMHSLKAADFKKLYPRW 400
gi 499221561 361 ERPDVFFPIEVRRIAADDAWLSPFYAAPRGSVAVHAYYRDDFTFLYELIEPIFRRYEGRPHWGKLHTLRGRQLEAIYPRW 440
gi 489503862 322 RSLPIMFPIEVRFSAPDDSFLSTAYGRDTCYIAVHQYAGMEFESYFRAVEEIMDDYAGRPHWGKRHYQTAATLRERYPQW 401
                        410       420
                 ....*....|....*....|....*.
gi 499217896 401 DDAMAVRRDIDPQNRFVSPYMAGLFG 426
gi 499221561 441 KDFLEVRQDLDPEARMLNPYLKGLFG 466
gi 489503862 402 DRFAAVRDRLDPDRVFLNDYTRRVLG 427
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap