1DV5,4BPH


Conserved Protein Domain Family
dltC

?
TIGR01688: dltC 
Click on image for an interactive view with Cn3D
D-alanine--poly(phosphoribitol) ligase, subunit 2
This protein is part of the teichoic acid operon in gram-positive organisms. Gram positive organisms incorporate teichoic acid in their cell walls, and in the fatty acid residues of the glycolipid component of the outer layer of the cytoplasmic membrane. This gene, dltC, encodes the alanyl carrier protein. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
Statistics
?
PSSM-Id: 130749
View PSSM: TIGR01688
Aligned: 5 rows
Threshold Bit Score: 104.54
Threshold Setting Gi: 4104107
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
1DV5_A      6 KNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQ 78
gi 4104107  4 REQVLDLLTEVAENNVIKENPDVELFEEGIFDSFQTVGLLLEIQNKLDIEVSIMDFDRDEWATPNKIVEVLEE 76
gi 1706448  7 KNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQ 79
gi 729342   4 KQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDSFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSE 76
4BPH_A      4 KQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDSFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSE 76
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap