1TCU,1YQQ


Conserved Protein Domain Family
PNPH-PUNA-XAPA

?
TIGR01697: PNPH-PUNA-XAPA 
Click on image for an interactive view with Cn3D
inosine/guanosine/xanthosine phosphorylase family
This model is a subset of the subfamily represented by pfam00896 (phosphorylase family 2). This model excludes the methylthioadenosine phosphorylases (MTAP, TIGR01684) which are believed toplay a specific role in the recycling of methionine from methylthioadenosine. In this subfamily is found three clades of purine phosphorylases based on a neighbor-joining tree using the MTAP family as an outgroup. The highest-branching clade (TIGR01698) consists of a group of sequences from both gram positive and gram negative bacteria which have been annotated as purine nucleotide phosphorylases but have not been further characterized as to substrate specificity. Of the two remaining clades, one is xanthosine phosphorylase (XAPA, TIGR01699), is limited to certain gamma proteobacteria and constitutes a special purine phosphorylase found in a specialized operon for xanthosine catabolism. The enzyme also acts on the same purines (inosine and guanosine) as the other characterized members of this subfamily, but is only induced when xanthosine must be degraded. The remaining and largest clade consists of purine nucleotide phosphorylases (PNPH, TIGR01700) from metazoa and bacteria which act primarily on guanosine and inosine (and do not act on adenosine). Sequences from Clostridium (GP:15025051) and Thermotoga (OMNI:TM1596) fall between these last two clades and are uncharacterized with respect to substrate range and operon.
Statistics
?
PSSM-Id: 130758
View PSSM: TIGR01697
Aligned: 11 rows
Threshold Bit Score: 346.258
Threshold Setting Gi: 15827299
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TCU_A        28 EIGIICGSGLGKLADGV-Kd-KITIPYTKIPNFPQTSVVGHSGNLIFGTLSGR--KVVVMQGRFHMYEG-YSNDTVALPI 102
gi 18146161   23 TIGLILGSGLGAIADQI-Ed-AEYFPYNEIPNFPVSTVEGHAGRLVIGKFQGK--EVVAMQGRFHYYEG-YSMQEVTCPV 97
gi 12958632   28 EIGIICGSGLGKLADGV-Kd-KITIPYTKIPNFPQTSVVGHSGNLIFGTLSGR--KVVVMQGRFHMYEG-YSNDTVALPI 102
gi 2854190    44 DLGIICGSGLGPIGDTV-Qd-ATILPYSKIPGFPTTHVVGHKGNMIFGKLGGK--KVVCLQGRFHPYEHnMDLALCTLPV 119
gi 16503641   27 RVAFILGSGLGALADQI-Ed-AVAISYEKLPGFPVSTVHGHAGELVLGHLAGV--PVACMKGRGHFYEG-RGMAVMTDAI 101
gi 5912369    42 KVAIICGSGLGTLASGL-SapVYEVPYEDIPHFHVSHVPGHASKLYFAFLGEKrvPTMILAGRYHSYEG-YPIEATTFPV 119
gi 492524991  24 KTAIILGSGLGELAEKI-En-KTVIPYNEIPHFAQATAVGHKGNIIGGILGGT--PVVAMQGRFHYYEG-YSMDQVTFPI 98
1YQQ_A        27 RVAFILGSGLGALADQI-En-AVAISYEKLPGFPVSTVHGHAGELVLGHLQGV--PVVCMKGRGHFYEG-RGMTIMTDAI 101
gi 490183424  21 DILIILGSGFGPFIEKV-Ed-PVIIDYKDIPHFPQPTVEGHSGKLVFGRISDK--PVMIMAGRFHLYEG-HDPATVAFPV 95
gi 499273277  19 RVAIVLGSGLGSLVEEV-Sd-PIRVPYANLPGFPTSGVSGHAGELVAGYLGGE--PVMMLSGRVHYYEK-GDPAAMRAVI 93
gi 499210346  29 DVAVVLGSGWSSAVAALgSs-RAVFPQAELPGFITPNAAGHTGELLSVRIGAH--RVLVLAGRIHPYEG-HDLRHVVHPV 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TCU_A       103 RVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLglnNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEE 182
gi 18146161   98 RVMRLLGVETLVVTNAAGAVNKDYTPGDLMIISDHLNLSGS---NPLIGKNLNEFGTRFPDMSNAYDKALRAQVKDIAKN 174
gi 12958632  103 RVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLglnNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEE 182
gi 2854190   120 RVMHQLGIKIMIVSNAAGGINAVLRHGDLMLIKDHIFLPALagfSPLVGCNDPRFGARFVSVHDAYDKQLRQLAIDVGRR 199
gi 16503641  102 RTLKLLGCEVLFCTNAAGSLRPEVGPGSLVALSDHINTMPG---TPMVGPNDDRYGDRFFSLANAYDADYRAMLQSVAAE 178
gi 5912369   120 RLMKVMGVEVMVVTNAAGGLNQGFKVGDLMILKDHINFPGLagmNPLRGPNAHEFGVRFPPLSDAYDLELRKLVYDAAKA 199
gi 492524991  99 RVMKLLGIENLFVSNAAGGINTSFKVGDLMIICDHINNLP----NPLIGPNMDMFGVRFPDMTRAYDREFIAKAKGIAQE 174
1YQQ_A       102 RTFKLLGCELLFCTNAAGSLRPEVGAGSLVALKDHINTMPG---TPMVGLNDDRFGERFFSLANAYDAEYRALLQKVAKE 178
gi 490183424  96 YLAKYVGVKGVVVTNAAGAINPEFKPGEIILVRDIINFMFR---NPLRGPNDEKIGPRFPDMSSVVDPEWARKIQERLS- 171
gi 499273277  94 EALAGLGVQSLILTNSAGSVRQDMPPGSVMQITDHINYSGM---NPLIGEESDR---RFVGMTTAYDPDLMLAMRNAAIR 167
gi 499210346 105 RTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTR---SPLVG-------THFVDLTNAYTTRLRKL----ASD 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1TCU_A       183 NGFGnlVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVldVESDLkpN---- 258
gi 18146161  175 LGIE--VREGVYAMFSGPTYETPAEVRMARILGADAVGMSTVPEVIIANHSGMKVIGVSCMTNMAAgiLEQPL--N---- 246
gi 12958632  183 NGFGnlVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISV--LDVESdlk---- 256
gi 2854190   200 SDMT--LYEGVYVMSGGPQYESPAEVSLFKTVGADALGMSTCHEVTVARQCGIKVLGFSLITNIAN--LDADAsve---- 271
gi 16503641  179 KGFP--LTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCGLKVVAVSAITNLAEglGDVKL--S---- 250
gi 5912369   200 HKVSrtIHEGCYAFVSGPCFETRAESRMLALMGADCVGMSTVPEVVVARHCGIRVLAISLVTNNVV--VEESP--Sakdl 275
gi 492524991 175 LNIP--VKEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITNEGYhfADDFV--Nd--- 247
1YQQ_A       179 EGFP--LTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCDLKVVAVSAITNMAEglSDVKL--S---- 250
gi 490183424 172 ------LKEGVYIGVLGPSYETPAEIRVFEKLGADLVGMSTVPEVIAAKHCGLKVVVFSCVTNMAAgiTHGRL--S---- 239
gi 499273277 168 ATVP--LFGGVYMWFSGPSFETPAEIRMARVLGADAVGMSTVPEVILARFFGMRVAAASVITNYGAgmTGAEL--S---- 239
gi 499210346 171 TDPT--LTEGVYAAQPGPHYETPAEIRMLRMLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAgiTGKPL--N---- 242
                        250       260       270
                 ....*....|....*....|....*....|....*...
1TCU_A       259 --------------HEEVLATGAQRAELMQSWFEKIIE 282
gi 18146161  247 --------------HEEVMETSAKVRKTFIELMTNIIK 270
gi 12958632  257 ------------pnHEEVLATGAQRAELMQSWFEKIIE 282
gi 2854190   272 ------------vsHEEVMDIAQQAGERASRFVSDIIT 297
gi 16503641  251 --------------HAQTLAAAELSRQNFINLICGFLR 274
gi 5912369   276 vevdsnvmskgaanHLEVLEVGIAAAADVRTMVETIVN 313
gi 492524991 248 --------------EQDVIRAANAASEKMGAIFARLIA 271
1YQQ_A       251 --------------HAQTLAAAELSKQNFINLICGFLR 274
gi 490183424 240 --------------HEEVVRTTKMAQGKIEKALTTAVE 263
gi 499273277 240 --------------HEETKDMAPVGGKRLAAILKEMIA 263
gi 499210346 243 --------------HAEVLAAGTASANRIGSLLADIIA 266
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap