1MJG,1JQK


Conserved Protein Domain Family
CO_DH_cata

?
TIGR01702: CO_DH_cata 
Click on image for an interactive view with Cn3D
carbon-monoxide dehydrogenase, catalytic subunit
This model represents the carbon-monoxide dehydrogenase catalytic subunit. This protein is related to prismane (also called hybrid cluster protein), a complex whose activity is not yet fully described; the two share similar sets of ligands to unusual metal-containing clusters.
Statistics
?
PSSM-Id: 130763
View PSSM: TIGR01702
Aligned: 8 rows
Threshold Bit Score: 930.701
Threshold Setting Gi: 399279
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MJG_A        28 TVDPAVLEMLVKSKDD-KVITAFDRFVAQQPQ-CKIGYEGICCRFCMAGPCRIKaTDGPGSRGICGASAWTIVARNVGLM 105
gi 399279     10 SSDACATEMLNLAEAN-SIETAWHRYEKQQPQ-CGFGSAGLCCRICLKGPCRIDpFGEGPKYGVCGADRDTIVARHLVRM 87
gi 15022942    9 VCDDADKTLRDFICGLnNVETSEHRVESQKNK-CKFGKDGVCCKLCANGPCR---ITPKSPRGICGADADTIVARNFLRA 84
gi 15025519   14 SYHDSVEEMVKKIRED-GMSNVFDRYALQEKIrCKFCLEGLSCQLCSNGPCRIS-EKTGQEKGVCGIGPDAMAMRNFLLK 91
gi 499172646   6 AAIPEVKEMVEKAKLK-GIETPHTRFPNQFPK-CPYGLKGVYCILCANGPCRI---TEKTPYGVCGATADVIVARNLCRA 80
gi 118340     28 TVDPAVLEMLVKSKDD-KVITAFDRFVAQQPQ-CKIGYEGICCRFCMAGPCRIKaTDGPGSRGICGASAWTIVARNVGLM 105
gi 499181803   8 SEHESINMMYERVSKE-GVTNIVDRFNAQEKGrCPFCEKGLSCQLCSMGPCRIS---KDKPTGACGIDAAGMVVRNFTHK 83
1JQK_A        10 SSDACATEMLNLAEAN-SIETAWHRYEKQQPQ-CGFGSAGLCCRICLKGPCRIDpFGEGPKYGVCGADRDTIVARHLVRM 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MJG_A       106 ILTGAAAHCEHGNHIAHALVEMAEGKAPdYSVKDEAKLKEVCRRVGIEVEGKSVlELAQEVGEKALEDFRRLkGEGEATW 185
gi 399279     88 IAAGTAAHSEHGRHIALAMQHISQGELHdYSIRDEAKLYAIAKTLGVATEGRGLlAIVGDLAAITLGDFQNQdYDKPCAW 167
gi 15022942   85 VAAGTACYVHVVETTARNLKALGENKKP---IKGMYTLNKLANMFKIDE-KDDH-KKAVMIADRVLSDLYKP-RFEKAEL 158
gi 15025519   92 NIMGAGTYSHHAYEAYRTLKATAEGRTP-FKITDENKLKWMCEKLGIDTAQSIN-DMAFELAVILEDQQRIG-VEDQNVM 168
gi 499172646  81 VAAGTSCYVHCAENAARALLSAGKGEGS-YEIRNEKKLKFLAKKLGFDANKDAK-QLAVEVAEFILDDMYKP-RWEKSEL 157
gi 118340    106 ILTGAAAHCEHGNHIAHALVEMAEGKAPdYSVKDEAKLKEVCRRVGIEVEGKSVlELAQEVGEKALEDFRRLkGEGEATW 185
gi 499181803  84 NMLGTEAYTYHAIEAAKTLKATAEGKTI-YEIKDVEKLKWFAKLLGIEGEDV-N-ELAAKVADFVISDLS---SLEKSRL 157
1JQK_A        88 IAAGTAAHSEHGRHIALAMQHISQGELHdYSIRDEAKLYAIAKTLGVATEGRGLlAIVGDLAAITLGDFQNQdYDKPCAW 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MJG_A       186 LMTTINEGRKEKFRTHNVVPFGIHASISELVNQAHMGMDNDPVNLVFSAIRVALAD-YTGEHIATDFSDILFGTPQPVVS 264
gi 399279    168 LAASLTPRRVKRLGDLGLLPHNIDASVAQTMSRTHVGCDADPTNLILGGLRVAMAD-LDGSMLATELSDALFGTPQPVVS 246
gi 15022942  159 VSEIAYAPRLKKWQELNILPGGAKSEVFDAIVKTSTNLNSDPVDMTVNCLTLGISTgLYGLTLTNLLNDVILGEPVIRQA 238
gi 15025519  169 VEAFAPKKRIEAWKKLGIYPAGTVHEEQNCVASCLTNVDGSHISLAMKALRLGIATiYNTQIGLEMVQDILFGTPTPHEV 248
gi 499172646 158 VPKLCPEKRLEVFEKLDILPGGAKGEIVDALTKTSTNLNSNPMDLLVHCLRLGLHAgFTGLLMTCWLNDILFGSPKITVV 237
gi 118340    186 LMTTINEGRKEKFRTHNVVPFGIHASISELVNQAHMGMDNDPVNLVFSAIRVALAD-YTGEHIATDFSDILFGTPQPVVS 264
gi 499181803 158 VEIFAPEKRKELWEKLGIFPSGVFQELLTMGSSAMTNVDSNYVSLAKKSMSMSIATcMAAQIALETIQDILFGTPMPHES 237
1JQK_A       168 LAASLTPRRVKRLGDLGLLPHNIDASVAQTMSRTHVGCDADPTNLILGGLRVAMAD-LDGSMLATELSDALFGTPQPVVS 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MJG_A       265 EANMGVLDPDQVNFVLHGHNPLLSEIIVQAAR--EMEGEAKAAG-AKGI-NLVGICCTGNEVLMRQG------IPLVTSF 334
gi 399279    247 AANLGVMKRGAVNIAVNGHNPMLSDIICDVAA--DLRDEAIAAGaAEGI-NIIGICCTGHEVMMRHG------VPLATNY 317
gi 15022942  239 NVGFKVVDPDYINIMITGHQHSVIEHLQERLIdeDITKKAQAIG-AKGF-KLVGCTCVGQDLQLRGEhykevfSGHAGNN 316
gi 15025519  249 NMDLGIMDPEYVNIVFNGHQPWIGAATILKAKtpEIQDMAKQAG-AKGL-RVVGSIETGQELLQRFPvde-vfVGHMGNW 325
gi 499172646 238 ENGFSSVKPNNVNIMITGHQHALIQPLCEAAMeeDLIKMAKEAG-ADEI-KIIGATCNGQDMETRIAhlpesfVGYIANN 315
gi 118340    265 EANMGVLDPDQVNFVLHGHNPLLSEIIVQAAR--EMEGEAKAAG-AKGI-NLVGICCTGNEVLMRQG------IPLVTSF 334
gi 499181803 238 HSDLGILDPEYVNIAVNGHEPFVGIALIKLAEreEIQEKARKAG-AKGL-RIIGFIETGQEILQRVDsp--vfAGIVGNW 313
1JQK_A       247 AANLGVMKRGAVNIAVNGHNPMLSDIICDVAA--DLRDEAIAAG-AAEGiNIIGICCTGHEVMMRHG------VPLATNY 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MJG_A       335 ASQELAICTGAIDAMCVDVQCIMPSISAVAECYHTRIITTADNAKIPGAYH-IDYQTATAIESAKTAIRMAIEAFKERKe 413
gi 399279    318 LSQELPILTGALEAMVVDVQCIMPSLPRIAECFHTQIITTDKHNKISGATH-VPFDEHKAVETAKTIIRMAIAAFGRRD- 395
gi 15022942  317 FTSEALIATGGIDLIMSEFNCTLPGIEPIAEEFEVKMICVDDVAKKKNADF-IKYSYEERENITDSIIEEALKSYENRRk 395
gi 15025519  326 LAIEPLLATGTVDIFAMEENCSPPAIDMYAEKYQVTLAAVSTIIDLPGVNYkFPYDPAQADETAQRLIELGIENFKKRKe 405
gi 499172646 316 FTTEPLVATGLIDAVVSEFNCTFHGLKFVAEKTKTKLICIDDMAYVEGAEY-IPWEPENAKEKAREIIKKAIEAFKERKg 394
gi 118340    335 ASQELAICTGAIDAMCVDVQCIMPSISAVAECYHTRIITTADNAKIPGAYH-IDYQTATAIESAKTAIRMAIEAFKERKe 413
gi 499181803 314 IVQEYALATGCVDVFAADMNCTLPSLPEY-QRYGVKIVPVSRLVRLKGIDEgLDYEPEKAEEIAMKLIDMAIENFKQRDk 392
1JQK_A       318 LSQELPILTGALEAMVVDVQCIMPSLPRIAECFHTQIITTDKHNKISGATH-VPFDEHKAVETAKTIIRMAIAAFGRRD- 395
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MJG_A       414 sNRPVYIPQIK--NRVVAGWSLEALTKLLATQN-----AqnpirVLNQAILDGELAGVALICGCNNLKGF-QDNSHLTVM 485
gi 399279    396 -PNRVAIPAFK--QKSIVGFSAEAVVAALAKVN-----AddplkPLVDNVVNGNIQGIVLFVGCNTTKVQ-QDSAYVDLA 466
gi 15022942  396 -DVTINIPKDHgyDDVVTGVSEKSLKDFLGGTW-----K-----PLVDLIASGKIKGVAGVVGCSNLTAKgHDVFTVELT 464
gi 15025519  406 -RQIKPHVPQKi-QKAIAGFSTEAVLGALGNKL-----D-----PLVDVIAKGQIKGVVALANCSTLRNGpQDWVTINLT 473
gi 499172646 395 -MQKDYY-DEK--VKSVVGVGEESLVEFLGGSV-----K-----PLIELIASGKIKGVVGVVGCSNLASGgHDNIIVTLT 460
gi 118340    414 sNRPVYIPQIK--NRVVAGWSLEALTKLLATQN-----AqnpirVLNQAILDGELAGVALICGCNNLKGF-QDNSHLTVM 485
gi 499181803 393 -SKAVKV-EQK--KKIVVGFSPEAILKALNGDL-----N-----VLLDAIKKGDIKGVVALVSCTTLKNGpHDSSTVTIA 458
1JQK_A       396 -PNRVAIPAFK--QKSIVGFSAEAVVAALAKVNaddplK-----PLVDNVVNGNIQGIVLFVGCNTTKVQ-QDSAYVDLA 466
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MJG_A       486 KELLKNNVFVVATGCSAQAAGKLGLLDPANVETYCGDGLKGFLKRLGeganieigLPPVFHMGSCVDNSRAVDLLMAMAN 565
gi 399279    467 KSLAKRNVLVLATGCAAGAFAKAGLMTSEATTQYAGEGLKGVLSAIGtaaglggpLPLVMHMGSCVDNSRAVALATALAN 546
gi 15022942  465 KELIKRNIIVLSAGCSSGGLENVGLMSPSAA-DLAGDSLKEVCKSLG--------IPPVLNFGPCLAIGRLEIVATELAE 535
gi 15025519  474 KELIKRDILVVSGGCGNHALEVAGLCTLDAANNIAGNGLKAVCNALK--------IPPVLSFGTCTDTGRISMLVTALAE 545
gi 499172646 461 KELIKRDILVLAGGCVNSPLKHAGLFDPASA-ELAGENLKEVCKSLG--------IPPVLNFGACLSIARIEQVAVAIAE 531
gi 118340    486 KELLKNNVFVVATGCSAQAAGKLGLLDPANVETYCGDGLKGFLKRLGeganieigLPPVFHMGSCVDNSRAVDLLMAMAN 565
gi 499181803 459 KELIKRDILVLSMGCGNAALQVAGLTSMEAV-ELAGEKLKAVCKALN--------IPPVLSFGTCTDTGRAAYLVRLIAD 529
1JQK_A       467 KSLAKRNVLVLATGCAAGAFAKAGLMTSEATTQYAGEGLKGVLSAIGtaaglggpLPLVMHMGSCVDNSRAVALATALAN 546
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MJG_A       566 DLGVDTPKVPFVASAPEAMSGKAAAIGTWWVSLGVPTHVGTMPPVEGSDLIYSILTQIASDVYGGYFIFEMDPQVAARKI 645
gi 399279    547 KLGVDLSDLPLVASAPECMSEKALAIGSWAVTIGLPTHVGSVPPVIGSQIVTKLVTETAKDLVGGYFIVDTDPKSAGDKL 626
gi 15022942  536 YLGIDIPQLPLVLSAPQWLEEQALADGAFGLSLGLPLHLAISPFIDGSAVVSKLLKEDLTDITGGKLIIEEDVIKAADKL 615
gi 15025519  546 HLNVDVPQLPIAVTAPEWMEQKATIDGIFALAYGAYTHLSPTPFMTGARQLVDLLTNKAEDVTGGKIALGDDPMKVANDI 625
gi 499172646 532 ELGVDIPDLPVAASAPQWLEEQALADATYAVDMGFTVHVSPVPFVTGSELVTKVLTEAVEGLTGGKLIPEPNPYKAADLL 611
gi 118340    566 DLGVDTPKVPFVASAPEAMSGKAAAIGTWWVSLGVPTHVGTMPPVEGSDLIYSILTQIASDVYGGYFIFEMDPQVAARKI 645
gi 499181803 530 ALGVDVPQLPVAVTAPEYMEQKATIDAVFAVAYGLTTHVSPVPPITGSEDAVKLFTEDVEKLTGGKVVVEEDPLKAAELL 609
1JQK_A       547 KLGVDLSDLPLVASAPECMSEKALAIGSWAVTIGLPTHVGSVPPVIGSQIVTKLVTETAKDLVGGYFIVDTDPKSAGDKL 626
                        650
                 ....*....|...
1MJG_A       646 LDALEYRTWKLGV 658
gi 399279    627 YAAIQERRAGLGL 639
gi 15022942  616 EREIIDRREKLGL 628
gi 15025519  626 EDHIMRKRKELGL 638
gi 499172646 612 EQTIMEKRKKLGI 624
gi 118340    646 LDALEYRTWKLGV 658
gi 499181803 610 EKVIEEKRKALGI 622
1JQK_A       627 YAAIQERRAGLGL 639
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap