Conserved Protein Domain Family
hybrid_clust

?
TIGR01703: hybrid_clust 
hydroxylamine reductase
This model represents a family of proteins containing an unusual 4Fe-2S-2O hydrid cluster. Earlier reports had proposed a 6Fe-6S prismane cluster. This subfamily is heterogeneous with respect to the presence or absence of a region of about 100 amino acids not far from the N-terminus of the protein. Members have been described as monomeric. The general function is unknown, although members from E. coli and several other species have hydroxylamine reductase activity. Members are found in various bacteria, in Archaea, and in several parasitic eukaryotes: Giardia intestinalis, Trichomonas vaginalis, and Entamoeba histolytica. [Cellular processes, Detoxification, Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130764
View PSSM: TIGR01703
Aligned: 7 rows
Threshold Bit Score: 710.813
Threshold Setting Gi: 14521200
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15979408    1 MFCVQCEQTIRtpaGNGCSyAQGMCGKTAETSDLQDLLVAVLQGLSAWALQARELGiID-SQIDSFAPRAFFSTLTNVNF 79
gi 15025787    3 MFCYQCQEAAG---CKGCT-VRGVCGKTEDLAKKQDLLIYTLKVVSLYNVEARKLN-LVnKEIDNYIVDSLFATITNANF 77
gi 18252520    1 MFCAQCEETNN---NTGCT-KKGVCGKQASTANIEDEMVQIVKEISIALGDGAVS-----IEMGELLNKTLFMTITNANF 71
gi 18252516    4 MFCNQCEQTAK---GTGCT-VCGVCTKEPIVSNTMDVLIYALRMNALVALKAKKNGiEVdNEYHVLTCSALFSTLTNVNF 79
gi 7404412     1 MFCYQCSQTVR---GRACT-IRGVCGKEP--------------------------------------------------- 25
gi 2829823     2 MFCYQCEQTTRspaGIGCTsEPGTCGKDEATAVLQDILTHLMKGIASMRAG-RAMGvAD-RRTDDFIFYGLFTTLTNVNF 79
gi 499169839   1 MLCNQCSMSLS---G-GCT-VRGVCGKDP--------------------------------------------------- 24
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15979408   80 DSDRIVEYAKDAILLRHSLAVRCRLLDSTitvdhplae---lqlvaddipSLLQQSqqFALNNDKADVGDDIHGLRMLCL 156
gi 15025787   78 DENIFTERIEKGIKYKEELKKQISAAGGN---------------------VNLNEK--TEAVGVLSTENEDIRSLRELLT 134
gi 18252520   72 DDIALKRQLDYCKEIKSKLTKKN------------------------------IT----APLGVNSHSNPDVVSLREMIL 117
gi 18252516   80 SEKDISQIVEQVFIQRKKLIEKLPKNELNgved-------------vedvAHYIEThlSDKRPNKWIDNQDIQSLMQTII 146
gi 7404412    26 ----------------------------------------------------------------------TVARLQDNLL 35
gi 2829823    80 TATRFVHLIQEASKRRERIKLLYEEAAREqgktpeilsgpalfqpadsleQLLRQApsVAINADVEHLGSDVIGARALIL 159
gi 499169839  25 ----------------------------------------------------------------------DLNSLQDALI 34
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15979408  157 YGLKGAAAYMEHAHVLGQSDEQIYAEYHAYMAWLGTQP-RDVDTLLNNAMGIGKMNFNVMAILDQGETQAYGDPQPTSVN 235
gi 15025787  135 YGIKGMAAYLKHARNLSYEDSNIQGFMSKALAATLDDT-LGADELVALALECGKYGVDAMALLDKANTETYGNPEITKVN 213
gi 18252520  118 YGIKGIAAYIDHAAMIGFHDPEIYAWQVKTLAKLSKE--EDINNLIALTLETGKYCVKGMELLDKANTSRYGKPEMTKVN 195
gi 18252516  147 FGLKGICAYVCHAHLLKKDNVQIFEFIQVALAAGYDGKeRTLEDWIHLTLEVGKWSLETMKLLDEAN-NTLGHPEPTEVL 225
gi 7404412    36 FAIKGISAYLYHARELGYTDEEVDAFLERGFYSTLTNVnFDAGEFIDLALEAGEMNIRTMKLLKKAHIDTYGEPEPTEVR 115
gi 2829823   160 YGMKGVALIAQHARVLGYQSDEVMPQAEEILDYLASNP-TDLDEMLEESLEVGRLNLKVMELLDVANTDSFGAQEITSVR 238
gi 499169839  35 YGIKGTAAYYYHALEMGYDNPEIGHFLAEALYSTLTNVnFDKNRFIDLILENGRIHLEAMKLLDKAYTETFGLPKPVEVP 114
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15979408  236 VRPVAGKAILISGHDLKDLHMLLEQTQG----TGINIYTHGEMLPAHGYPELKRYPHLVGNYGSGWQNQQTEFAKFPGPI 311
gi 15025787  214 IGTRNNPGILISGHDLKDIEELLKQTEG----TGVDVYTHSEMLPANYYPAFKKYSHFVGNYGNAWWKQNEEFESFNGPI 289
gi 18252520  196 IGVGTRPGILVSGHDLRDLEDLLEQTKD----SGVDVYTHGEMLPARGYPFFKRYPHLRGNYGGPWFRQDREFGPFNGPI 271
gi 18252516  226 IGHKAGKCILVTGHDLHDLELLLKQTEG----KGVNVYTHGEMLPAHGYPLLKKYKHLIGHFGTAWQNQQREFPTFPGAI 301
gi 7404412   116 VGALEGPAIIATGHSLRALEELLKQTEG----TGINVYTHSELLPAHGYPGLRKYPHLAGQLGGPWFDQKDTFSRYTAAI 191
gi 2829823   239 ISPIQGKAILVSGHDLHDLKQILEQTKD----QGINVYTHGEMLPANAYPLLKAYPHLAGNLGGAWQDQQREFADFPGPI 314
gi 499169839 115 TGTTEGHGIVVTGHSYKALYELLNQIREmgleEEIKVYTHSEMLPAHSYPEIRKFKSLYGNWGGSWVYQRKEFAEFPGVI 194
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15979408  312 LMTSNCIIDPNvgNYGDRIWTRSIVGWPGVNHLDGD-------NFAPVIEQALGMAgFPYSELEHLITVGFGRQTLLNA- 383
gi 15025787  290 LMTTNCIVPPKa-SYIDRMYTTGVTGYPGVKHIENGep----kDFSAIIEHAKKCA-PPTEIEKGEIIGGFAHNQVIAL- 362
gi 18252520  272 FMTTNCIVPVRk-EYKDRIFTTGAVGWPELKHIPDRkdvngqkDFSEIVALAKTCP-PPKELEKGQVTVGLAHDQVLAV- 348
gi 18252516  302 LFTTNCLMKPLp-SYKDRVFTTNEVGFNGLVHIGNDk------DFTPVIQKALEMEgFTDDLKEDTVTTGFSHHAILEEk 374
gi 7404412   192 LGTSNCVLLPRd-DYRDRMFTCGVAALPGVEHLEGY-------DFSPLIDKALELPpLSEE-DATTLTTGFGLSTILSL- 261
gi 2829823   315 VMTSNCIIEPGr-SYKNRIFTLGPVGWPGVRHIDNG-------DFTPVIQAAKALPgFTADAKEQRITIGFGHHTLLGV- 385
gi 499169839 195 IGTSNCVQQPTk-AYQDRIFTVGIAGLEGVPHLEDY-------DFEPAIKRALETPkMGKR-EGEKIVTGFHHTYILAM- 264
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15979408  384 -ADTVIDLVASKKLRHVFLVGGCDGSRTERSYFTDFARSVPQDCIIMTLACGKYRFNKLDFGTLEGLPRLLDVGQCNDAY 462
gi 15025787  363 -ADKVVEAVKSGAIKRFYVMAGCDGRAKTRNYYTDFAKALPKDAVILTAGCAKYKYNKLDLGDIGGIPRVLDAGQCNDSY 441
gi 18252520  349 -ADKIVEGVKNGQIKKFVCMGGCDGRHKERDYYTKVAKALPKDTLILTAGCAKYRYNKLDLGDINGIPRVIDAGQCNDSY 427
gi 18252516  375 tANKLVSLIKEGKIKNIFVVGGCDGAKAGRNYYTELVQKIPKDSIILTCACGKFRFFREKLGDIEGIPRLLDLGQCNDSY 454
gi 7404412   262 -ADKIRELVEDGKIRRFFLVGGCDSPLPRAKYYTEFVRKLPEDTVVLTLACGKYRFNSMDLGDIEGVPRLIDLGQCNDAI 340
gi 2829823   386 -ADKIVDAVKHGDIRHFFLVGGCDGVSPARNYFTEVADNAPADSVVMTLGCGKYRFNKHEFGDIGGIPRLLDIGQCNDAH 464
gi 499169839 265 -KDKLIELINEGKIRHIFVIGGCDVPNPKMSYYEKLTELVPRDAIILSAACGKFRYNRRDYGSIEGIPRFMDFGQCNNVY 343
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15979408  463 AAIMLAVKLSEKLGCT-VNDLPLSLVLSWFEQKAIVILLTLLSLGVKNIYTGPTAPGFLTDNLMAILYEKFGMQP--ITT 539
gi 15025787  442 SLVVIALKLKEVFGLNdINELPIAYNIAWYEQKAVIVLLALLHLGVKNIHLGPTLPAFLSPNVAKVLVDNFGIGG--ITN 519
gi 18252520  428 SLAIIALKLKKVFGLDdVNKLPLAFDIAWYEQKAACILLALLFLGFKNIRVGPTLPGFLSPNVANVLVKNFGIKG--IGS 505
gi 18252516  455 SAIVVALKLAEIFKCG-VNELPLHLILSWYEQKAVAVLLALLYLGIKNIRIGPSAPAFLTPGVFKYLHDNLNLMM--TTT 531
gi 7404412   341 VAVELVEALSNLFQMD-INELPLSIILSWMEQKAAAILWSLLSLDLKGMYIGPILPGWANEDIVKFLVDNYDLTP--IGD 417
gi 2829823   465 SAIRVAGALAEAFNCG-VNDLPLSIMLSWFEQKATAIHLSLLALGIKGIKLGPTLPAYLTPTLVQKLQSRFDLDLdlIGE 543
gi 499169839 344 SIIEIALALAKELDMD-INSLPVSIVLSWMEQKAIGILYTLLYLGVKGIYIGPKSPEFLTPRVFEILRKQFDLRL--ISE 420

                 ....*....
gi 15979408  540 VEQDMQAIL 548
gi 15025787  520 VEDDIKMFE 528
gi 18252520  506 IEDDLKDIL 514
gi 18252516  532 PDNDLANL- 539
gi 7404412   418 PEEDIRKIL 426
gi 2829823   544 AQADLQAAL 552
gi 499169839 421 PEKDLREML 429
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap