Conserved Protein Domain Family
typeII_sec_gspH

?
TIGR01708: typeII_sec_gspH 
type II secretion system protein H
This model represents GspH, protein H of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 130769
View PSSM: TIGR01708
Aligned: 4 rows
Threshold Bit Score: 160.038
Threshold Setting Gi: 13475689
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 399806      4 HRQSGFTLLEVLLVAMLMGLVATAVTLSMGGaRGDRELDKQARRFMATLQQAQEYSVMDGRL--VGLRIEDHGWQFMQRA 81
gi 9946558     4 PRQSGFTLIELMVVLVIVGIATAAISLSARP-DPTGLLRQDAARLARLLEIAQGEARVRGTP--ILWQPSAKGYRFSPQA 80
gi 3293033     2 RREQGFSLIELLVVLAIAGLMTSLAVAWLD--SGKTNVDQALQRLAAETRTQAALARHAGQLr--GLRWTGQRPEFVRRE 77
gi 499216812  12 HATAGFTLVEMLVVLAIMALVAAIAAPGLVShYRTKSLETVAGEITMRLRLSRTSAIATARPkqVLVDLGSRVIRFGERD 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 399806     82 AKDRKwqaltgdkilgqvqlpdtmllAIELEGFSWRTESDEKTERGRDEkertpqVLIFPGGELSPFVLTLTQQDEDVry 161
gi 9946558    81 YRGKTdaf----------------aaDTELRARDWQAAPLRVSVRPPRP------VLLDAEWIGAPLRITLSDGQHSV-- 136
gi 3293033    78 GDAWV---------------------VETVALGDWPKGLR-PDWPASAQp----hLLFTPQGWAQPGSVRWHWAKGSQ-- 129
gi 499216812  92 SLALP----------------------DDVKMTVITGQETVVADRQTVLt-------FLPDGRASGMDMALQRKGRTA-- 140
                        170
                 ....*....|....*
gi 399806    162 lrTVKADEFGRLRLL 176
gi 9946558   137 --TVLREANGHVRVR 149
gi 3293033   130 --QWAWRRDGKLQLA 142
gi 499216812 141 --RIAVNWLTGLPTW 153
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap