Conserved Protein Domain Family
gspJ

?
TIGR01711: gspJ 
type II secretion system protein J
This model represents GspJ, one of two proteins highly conserved at their N-termini and described by pfam02501 but easily separable phylogenetically. The other is GspI. Both GspI and GspJ are proteins of the type II secretion pathway, or main terminal branch of the general secretion pathway. This pathway carries proteins across the outer membrane. Note that proteins of type II secretion are cryptic in E. coli K-12 - present but not yet demonstrated to act on any target.
Statistics
?
PSSM-Id: 130772
View PSSM: TIGR01711
Aligned: 3 rows
Threshold Bit Score: 282.573
Threshold Setting Gi: 139794
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 12644269  14 AGFTLIEVLVAIAIFASLSVGAYQVLNQVQRSNEISAERTARLAELQRAMVIMDADFRQMALRQFRTDGEApSEQILQWK 93
gi 399814     6 GGFTLLEMLVAIAIFASLSMGAYQVLQGVLTSDEVAKKKEARLSELQLAFTLMERDITQMVPRSGRIDGEN-NKVLLAAS 84
gi 139794     5 RGFTLLELLIAIAIFALLALATYRMFDSVMQTDQATRVQEQRMRELVRAMGALERDLTQAVERPVRDELG-----DNRGA 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 12644269  94 ESLLDSDQHGLLFVRLGWHNPQQQFPRGEVAKVGYRLFENRLERVWWRYPDTPAGQQGLISPLLTGVEDWAVQFYLQ-GE 172
gi 399814    85 RFGQQSDDWGMAFIRGGWLNPDGMLPRSGLQRVGWRLKDHKLERLSYLYPDPVIGTEPRIQPMLDRVTALRLYFYDK-GA 163
gi 139794    80 FLSEGENDQIVEFTRGGWRNPLG-QARSRLQRVRWSLSGETLERRYWLVLDRAQDSKPRVQQVLDGVTALSWRFLDKeHN 158
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 12644269 173 WSKEWVPTN--------ALPEAVKVTLRLKDYGEIERIYLTG 206
gi 399814   164 WKEEWTQRN--------VLPYGLAVELDLEDYGTLRRQFLIG 197
gi 139794   159 WQGHWPTDEgseeerleSLPLAVEMTLEHRHYGKLVRVWRLL 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap