Conserved Protein Domain Family
phage_rep_org_N

?
TIGR01714: phage_rep_org_N 
phage replisome organizer, putative, N-terminal region
This model represents the N-terminal domain of a small family of phage proteins. The protein contains a region of low-complexity sequence that reflects DNA direct repeats able to function as an origin of phage replication. The region covered by this model is N-terminal to the low-complexity region. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130775
View PSSM: TIGR01714
Aligned: 4 rows
Threshold Bit Score: 168.438
Threshold Setting Gi: 12697193
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19748911    9 YLKLKENFFESDEAIILESMPDGYIYSNILLKLYLRS--LKNDGLLMFNNLIPYNAQMLATITRHQIGTVEKAIQIFRDL 86
gi 12697193   10 WIQLTQDFFKSKEMKLLRKIAGGDTHTIIYLKMMLIS--LEDGGCIYYDGLADNLAEEIALMIDENVEDIKITLLFLESK 87
gi 502716964   6 WIKLSVNMFDDEKIKLLEKMPEGNQMLIVWIRLLALAgkTNDKGRIYLNENVPYTEDMLATLFNRDVGIIRVTLHTLQSF 85
gi 610791060   6 WIKLKVGMFDDSKIKYIEALPERDTIITIWVKLLTLSgkYNEQGYIMLSENLPYNEEMLANEFNRPINSIRLAIQTFETL 85
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 19748911   87 QLIEILDNGAIYMTNIQNFVGKSSTDADRKRIEYAKTKQLE 127
gi 12697193   88 GLLTRKNDRDYFLEQVPEMVGSETASARRVRKFRENQLALQ 128
gi 502716964  86 GMIQKTENGLIEIENWEKHQNVDGMERVREQTRKRVEKHRE 126
gi 610791060  86 GMIEKVN-GVIKVTNWEKHQSLDSKAKHKEKNKLRQQRYRE 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap