1K3F


Conserved Protein Domain Family
Uridine-psphlse

?
TIGR01718: Uridine-psphlse 
Click on image for an interactive view with Cn3D
uridine phosphorylase
This model represents a family of bacterial and archaeal uridine phosphorylases unrelated to the mammalian enzymes of the same name. The E. coli, Salmonella and Klebsiella genes have been characterized. Sequences from Clostridium, Streptomyces, Treponema, Halobacterium and Pyrobaculum were included above trusted on the basis of sequence homology and a PAM-based neighbor-joining tree. A clade including second sequences from Halobacterium and Vibrio was somewhat more distantly related and may represent a slightly different substrate specificity - these were placed below the noise cutoff. More distantly related is a clade of archaeal sequences which as related to the DeoD family of inosine phosphorylases (TIGR00107) as they are to these uridine phosphorylases. This clade includes a characterized protein from Sulfolobus solfataricus which has been mis-named as a methylthioadenosine phosphorylase, but which acts on inosine and guanosine - it is unclear whether uridine has been evaluated as a substrate. [Purines, pyrimidines, nucleosides, and nucleotides, Salvage of nucleosides and nucleotides]
Statistics
?
PSSM-Id: 130779
View PSSM: TIGR01718
Aligned: 4 rows
Threshold Bit Score: 397.343
Threshold Setting Gi: 18161392
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1K3F_A        6 VFHLGLTKNDLQgaTLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLG 85
gi 18161392  11 AYHLLLAQGEIP--RYVLLPGDPGRVPLIAKHWDEAREVARNREFVTYVGRYKGVSIGATSTGIGSGSTAIAVEELLYAG 88
gi 6136115   10 EYHIGLKASDIG--HYVILPGDPARSEKIAQHFSHPHKVGHNREYVTYTGTLCETPVSVMSTGIGGPSTAIGVEELIHLG 87
gi 136740     6 VFHLGLTKNDLQgaTLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLG 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1K3F_A       86 IRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPG 165
gi 18161392  89 ADTFIRVGTTGALWRHIKLGDLIIGAAAVRWDGASRWYAPPEYPAVAHWVVVNALVKAAESLGVRHHVGIVASTDSFYVG 168
gi 6136115   88 AHTFIRVGTSGGMQPDILAGTVVIATGAIRFEGTSKEYAPVEFPAVPDFTVTAALKHAAEDVQVRHALGVVQCKDNFYGQ 167
gi 136740    86 IRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPG 165
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1K3F_A      166 QERyDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAEtmkqTESHAVKIV 245
gi 18161392 169 QER-PGHGGFLPPWAKGLIEALRGLMVLSFEMESATIFTLASIYGARAGGVYAVIANRETDEFAPEV----GVEEAIKVA 243
gi 6136115  168 HSP-HTMP--VHAELTQKWHAWIACNTLASEMESAALFVLGSVRRVRTGAVLLVIGNQTRRAQGLEDiqvhDTENAIRVA 244
gi 136740   166 QERyDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAEtmkqTESHAVKIV 245

                ....*...
1K3F_A      246 VEAARRLL 253
gi 18161392 244 NEAVKILA 251
gi 6136115  245 VEAVKLLI 252
gi 136740   246 VEAARRLL 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap