3EUE


Conserved Protein Domain Family
euk_UDPppase

?
TIGR01719: euk_UDPppase 
Click on image for an interactive view with Cn3D
uridine phosphorylase
This model represents a clade of mainly eucaryotic uridine phosphorylases. Genes from human and mouse have been characterized. This enzyme is a member of the PHP/UDP subfamily (pfam01048) and is closely related to the bacterial uridine (TIGR01718) and inosine (TIGR00107) phosphorylase equivalogs. In addition to the eukaryotes, a gene from Mycobacterium leprae is included in this equivalog and may have resulted from lateral gene transfer. [Purines, pyrimidines, nucleosides, and nucleotides, Salvage of nucleosides and nucleotides]
Statistics
?
PSSM-Id: 130780
View PSSM: TIGR01719
Aligned: 6 rows
Threshold Bit Score: 456.144
Threshold Setting Gi: 13093720
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3EUE_A       41 NPNIAKMK-EDILYHFNLTTS----RHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCp-GRDYPNICAGTDRYA 114
gi 2494059   23 NPNIAKMK-EDILYHFNLTTS----RHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCp-GRDYPNICAGTDRYA 96
gi 532114   436 NKYFDIKDkRDFLYHFGFGVD----TLDIPAVFGDTKFVCTGGSPGRFKLYAEWFAKEANIPC-----SENLS-RSDRFV 505
gi 7295864    2 NPHLETAR-SDYLYHLDINVAntrdTSELQNRFGDVRVICMGGTGSRMRQLALYLRDILVVSE--SGDPVDLCERGNRYA 78
gi 13093720  26 DGVLDGSH-EDVYYHFGIASS-----DPALDELRDVKAVILAGTRERITTFADRWSELNGGSK--VSRVIAFS-KEDRFV 96
gi 7291505   52 NPCLKCLQ-PDILYHLGLNTE----TTDFPKVFGDVRFVCMGGTPGRMENFAYYVMQEIGLKInaATKLRNISEAGQRFS 126
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3EUE_A      115 MYKVGPVLSVSHGMGIPSISIMLHELIKLLYYAR------CSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQI 188
gi 2494059   97 MYKVGPVLSVSHGMGIPSISIMLHELIKLLYYAR------CSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQI 170
gi 532114   506 IYKTGPVCWINHGMGTPSLSIMLVESFKLMHHAG------VKNPTFIRLGTSGGVGVPPGTVVVSTEAMNAELGDTYVQI 579
gi 7295864   79 MYKVGPVLCVSHGVGSSSFSVVLHELIKLLKYAR------CQDPVLLRIGTCGGLGVPPGTVVASKNAFNGLLRNEHEIA 152
gi 13093720  97 TRYTAGVLFASHGMGMASASIALQELMRLVFFLKrgdleaLDKVFWCRVGTSGGIGLPSGTVVVSSEGLMADLQP-YRLL 175
gi 7291505  127 LFKVGPVLCASHGMGCPSISILLHELIKMMYHAK------CKDPVFIRIGTSGGIGVEPGTVIISSEAIDGRLNPVHEIL 200
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3EUE_A      189 VLGKRVIRKTDLNKKLVQELLLCSAE-LSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEM 267
gi 2494059  171 VLGKRVIRKTDLNKKLVQELLLCSAE-LSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEM 249
gi 532114   580 IAGKRIERPTQLDAALREALCEVGKE--KSIPVETGKTMCADDFYEGQMRLDGYFCDYEEEDKYAFLRKLNALGVRNIEM 657
gi 7295864  153 ILGQRVVRPAQFSEDVIRDLLAFGVDaNDGFQTISANTMGTDCFYEGQGRTDGAICEYSEKDKMEFLQKCHDLGIRNIEM 232
gi 13093720 176 RGGDSEYWFDGCFPAGTHNAIIAANEgIDDLAMVSGRTVSGNEFFLEQFRLDGAVCFETPTTKMAWLRWLDENGVRNIEM 255
gi 7291505  201 VHGVSVQHASQLDESLADEIKMCHDPcKDKYEAVIGRTLCAHDFYEGQSRLDGAFCEYTPEMKKSYLETLQSQQVKNIEM 280
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|.
3EUE_A      268 ESSVFAAMCSACGL-QAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK 327
gi 2494059  250 ESSVFAAMCSACGL-QAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK 309
gi 532114   658 ESTCFASFTCRAGF-QSAIVCVTLLNRMDGDQVQIAKEQYIEYEERPFRLVTAYIRKQTGI 717
gi 7295864  233 EASMFASVTQKVGV-KAGDVCVTLIDRLKGDQITITIDQKHEFEQRPFFVVGRYIKRLLQQ 292
gi 13093720 256 EGAMIAGYLNHWGFpKFAMICCTLLNRLEGDQVTATPVQLHKFSEDLGAALFNYLKVSLLN 316
gi 7291505  281 ESLAFAALTSRANI-RGAVVCVAILNRLNGDQIKTPHDVLSKWEKRPQELVARYIRKVLYH 340
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap