1YBF


Conserved Protein Domain Family
AMN-like

?
TIGR01721: AMN-like 
Click on image for an interactive view with Cn3D
AMP nucleosidase, putative
The sequences in the clade represented by this model are most closely related to the AMP nucleosidase found in TIGR01717. These sequences are found only in Chlamydia and Porphyromonas and differ sufficiently from the characterized AMP nucleosidase to put some doubt on assignment of this name.
Statistics
?
PSSM-Id: 130782
View PSSM: TIGR01721
Aligned: 3 rows
Threshold Bit Score: 448.987
Threshold Setting Gi: 58177597
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YBF_A         4 KTKQEIVENWLPRYTQRQLIDFEPYILLTNFSHYLHVFAEHYGVPIV-GEHTSXPNASAEGVTLINFGXGSANAATIXDL 82
gi 497915327   8 ISEGTIARDMLERYTGSTIQEFQPYLLLTNFAYYVDVFAEIYQVPVSrGSMFSAAHAPQTCTSIIDFKLGSPGAALIVDL 87
gi 499185989   5 TSESRIAQDMLERYSGSSVKQFCPYLLLTNFSYYIQTFAKLHGVPVFeGSMFSAAHAPHLKTSILDFKLGSPGAALTIDL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YBF_A        83 L-WAIHPKAVIFLGKCGGLKLENALGDYLLPIAAIRGEGTSNDYLPEEVPSLPSFSVLRAISSAIQNKGKDYWTGTVYTT 161
gi 497915327  88 CsFLPNALAAVMLGMCGGLRSHYQVGDYFVPVASIRKDGTSDAYFPPEVPALANFVVQKTITNILEEKNLPYHIGITHTT 167
gi 499185989  85 CsFLPDLKAALMLGMCGGLRSHYQVGDYFVPVASIRGEGTSDAYFPPEVPALANFVVQKATTEVLEDKKANYHIGITHTT 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YBF_A       162 NRRVWEYDEKFKDYLRSTHASGVDXETATLXTVGFANKIPXGALLLISDRPXFPEGVKTEESDQLVTDNFAEEHLXLGID 241
gi 497915327 168 NIRFWEFNKEFRRKLYENKAQTVEMECATLFSAGYRRNLPLGALLLISDLPLRRDGIKTKQSSSEVLATYTKKHILTGIE 247
gi 499185989 165 NIRFWEFNKKFRKKLYETKAQSAEMECATLFAAGYRRNLPIGALLLISDLPLRKEGIKTKSSGNFIFNTYTEDHILTGQE 244
                        250       260       270
                 ....*....|....*....|....*....|...
1YBF_A       242 ALEIIR----E------NKS---S-IKHIRFNW 260
gi 497915327 248 VFASLQ----EtvgpgiKKT---KgLPHMEFGQ 273
gi 499185989 245 VIENLEkvmlKraasdhKKDqqyRgLPHMEVGE 277
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap