Conserved Protein Domain Family
hmd_rel

?
TIGR01724: hmd_rel 
H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein
This model represents a sister clade to the authenticated coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin reductase (HMD) of TIGR01723. Two members, designated HmdII and HmdIII, are found. Members are restricted to methanogens, but the function is unknown. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 130785
View PSSM: TIGR01724
Aligned: 3 rows
Threshold Bit Score: 632.723
Threshold Setting Gi: 2833553
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2842594    12 MKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAK 91
gi 2833553     1 MKISIYGAGNQRLYLEQLKVPEKFGGEPPYGGAGMAIEFAKAGHDVVLSEPNRDVMSDDLWKKVEDAGVKVVSDDIEAAK 80
gi 499178603   7 MKVTVYGAGNQKLYTDELNLPERYGGEAPYGGSRMAMEFAMAGHDVILAEPSREFLDDEQWSMVEEAGVTVTDNDKEAAS 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2842594    92 HGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIG 171
gi 2833553    81 HGEIHVLFTPFGRITLNIANTIIEHVPENAIICNTCTIPTPVLYRSLEGILRLKRRDVGISSMHPTGVPGTPSQKYYTIA 160
gi 499178603  87 EAEVAVLFTPFGKGTFSIAREILPELPEGSVIANTCTVSPVVLYYVLEKELKLERTDVGVSSMHPAAVPGTPQHGHYVIG 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2842594   172 GKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMT 251
gi 2833553   161 GKALEGKEYATEDQINKLVELVKSVGKIPYVTPADVVPAVADMGALVTAVALVGVLDYYRVGTQIINAPKDMIEKQILIS 240
gi 499178603 167 GRPTAELDMATDEQVSRCAELAESTGKKAYIVPADVTSAVADMGSLVTAVALAGVLDYYYVGTQIIKAPEEMVEKQILMT 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2842594   252 LQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLkaeVEKAEIKPTTLVAAQSLVKEIK 331
gi 2833553   241 LQTIASIIETSGMEGLMKVFNKDALLSSAKNMLIDERQEDLNLALKIIEEFDKST---IGEKDISQTYLVAPQALIKEAV 317
gi 499178603 247 LQTMASLVETSGVDGMAAAINPELLVKSARSMHLLDEQEELDAALKKISDLNDDVmkwIEGAEVNHTDLVAAQALTGELK 326
                        330       340
                 ....*....|....*....|.
gi 2842594   332 TLIGGAAAEGAIKRSARKLFE 352
gi 2833553   318 SLIGKSAVEGMIRRSSNKLFK 338
gi 499178603 327 TVIGDRAAEGTIRRCMRKMFE 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap