Conserved Protein Domain Family
HEQRo_perm_3TM

?
TIGR01726: HEQRo_perm_3TM 
amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
This model represents one of several classes of multiple membrane spanning regions found immediately N-terminal to the domain described by pfam00528, binding-protein-dependent transport systems inner membrane component. The region covered by this model generally is predicted to contain three transmembrane helices. Substrate specificities attributed to members of this family include histidine, arginine, glutamine, glutamate, and (in Agrobacterium) the opines octopine and nopaline. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130787
View PSSM: TIGR01726
Aligned: 25 rows
Threshold Bit Score: 90.2843
Threshold Setting Gi: 19745969
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23024002  276 NDGAFLKGLWLTIELTVLAIILASIWGVILGVMGVSQNSAVRGLSTTLIYIFRGLPLMVLAFFIYIGLPgVIGTKIPAFT 355
gi 22989058   40 NLQPIAAGLATTLGTWAAGVAIGMLIGFLIAVLQLFCGRWVRGILRVYIELFRGTPFLVQLFLLYYGGP-SFGLTLEPMT 118
gi 22986404   48 FVPILIQGAVMSIVITLGCLLLSTVLGLTWALLKMSRYPLVVRGVSTMINVVRGLPMIVLLFYIYFVLP-EIHIQVSALQ 126
gi 6689163    11 FMPHFWDGLLVTLQILVLGSLVSFGLGLVWALLMRVPSRWVTWPVGVVTEFVRNTPLLVQLFFLFYVLP-EWNITFSALT 89
gi 631616251  40 NKDAFINGFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELFQNVPLVIQIFFLFYALP-VLGIRLDIFT 118
gi 493276471  11 NWTLFARGTWLTIVIAIVAIATGFLISIPIALMALSHRRPLRWISSAYVEWFRNIPFIVVLYLFFYGLP-FMGVRLPESI 89
gi 493357071  11 FSPAFFHGALLTLVITVTSLFFGMIAGLIVALLQESRIRPLQIFTLVYLWLFRGTPVLFQIIFIYNVLP-TFGVMLSAFV 89
gi 499215675  16 SLPALLRGFLNTLLLGILSIGIGIPIGLLISLVRLYAPKPLRWLAVGYTDIFRALPVLVVLILIYYALP-FLGIRLSSWA 94
gi 484888592   9 YLPLYQKAFFLTLHIAVWGILGSFLLGLIVSIIRHYRIPVLAQVATAYIELSRNTPLLIQLFFLYFGLP-RIGIVLSSEV 87
gi 515835325  35 lsfLISQGVVTTLYISVISIAVATVIALVGAIAKLSKNGVIYGLATFYTSLFRGLPLLMQIYIIYLGLP-QVGYVISAVP 113
                         90       100
                 ....*....|....*....|
gi 23024002  356 AGLITLILNEGAYTGAFVRG 375
gi 22989058  119 AGVLGLGLYGSAYFAEAFRS 138
gi 22986404  127 ASIIGLGFGYSTYVAEIFRA 146
gi 6689163    90 TGVVAIGLHYSTYTMQVYRA 109
gi 631616251 119 IGVLGVGAYHGAYVSEVVRS 138
gi 493276471  90 VGTIALAFFASSYFAEIIRG 109
gi 493357071  90 SAVIALSLNEGAYMAEIIRS 109
gi 499215675  95 SAVTAFAFIMSAYSAEVFRS 114
gi 484888592  88 CATLGLVFLGGSYMAESFRS 107
gi 515835325 114 AGILALSLCYGAYMTEIFRA 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap