Conserved Protein Domain Family
staph_tand_hypo

?
TIGR01741: staph_tand_hypo 
conserved hypothetical protein
This model represents a tandem array of 10 proteins in Staphylococcus aureus and the C-terminal region of one protein each in Bacillus subtilis and Bacillus halodurans.
Statistics
?
PSSM-Id: 130802
View PSSM: TIGR01741
Aligned: 3 rows
Threshold Bit Score: 228.241
Threshold Setting Gi: 57652562
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2318065   213 RMETRKMQDLYQLIGEKLNDIIPGEWTKIYLYAEVLDDSTMVLFHFRTPENNQIIYSQDIPSHYNVSKDIFKTLLRELRE 292
gi 477879855  14 MTFEEKLSQMYNEIANEISGMIPVEWEKVYTIAYVDDEGGEVVFNYTKPGSEDLNYYSDIPKDCNVSKDIFKNSWFKVYR 93
gi 558555797  26 MTFEEKLSEMYSEIANKIISMIPVEWEKVYAMAYIDEECGEVFYNYTEPSSDELFYYTSVIKKYNLLKSSFMDSVYELHD 105
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 2318065   293 LFEELRTEHRNNNDDVWTNLTLTLDRSGEFQLDYNYDDILASELDGYERIAIWEYKNLGILPEDEDDKEFVISYLGL 369
gi 477879855  94 MFDELRETFKKEDLEPWTSCEFDFTRKGNLKVSFDYIDWIKLGFGPSGKENYYMYKKFGILPDMEYEMEEIRAVEKY 170
gi 558555797 106 QFEELREVFIEEGLEPWTSCEFDFTKEDKLKVSFDYIDWINTEFDQLGRENYYMYKKFGVLPETEYEINKVKEIEQY 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap