1P4A


Conserved Protein Domain Family
purR_Bsub

?
TIGR01743: purR_Bsub 
Click on image for an interactive view with Cn3D
pur operon repressor, Bacillus subtilis type
This model represents the puring operon repressor PurR of low-GC Gram-positive bacteria. This homodimeric repressor contains a large region homologous to phosphoribosyltransferases and is inhibited by 5-phosphoribosyl 1-pyrophosphate. [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130804
View PSSM: TIGR01743
Aligned: 5 rows
Threshold Bit Score: 435.752
Threshold Setting Gi: 18311474
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1P4A_A         3 FRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEE 82
gi 586880      3 FRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEE 82
gi 20517584    5 YKRYERLVALLKFFTDNPNKLVNLEQFMDMFNIAKSSASEDIDILEEILEKFDMGKLMTFPGAGGGVKYIPVSSLKSYVP 84
gi 499320435   4 LSRNSRVSIITKVLIENPNKIIGLNKFSDLLNAAKSTISEDIVIVREVLSKFSMGKVETIAGAAGGIRYIPEVGEVEKRK 83
gi 20139613    3 LRRSDRMVVISNYLINNPYKLTSLNTFAEKYESAKSSISEDIVIIKRAFEEIEIGHIQTVTGAGGGVIFTPSISSQDAKE 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1P4A_A        83 FVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKD 162
gi 586880     83 FVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKD 162
gi 20517584   85 FVKEVCERLKDPSRIIPGGFLYTADLIYSPPIVSKIAEVLVYPFIEKEIDAVVTVETKGIPIALMCARVLNVPLVIVRKD 164
gi 499320435  84 FLEELCDIASESNRVVPGNFLYVTDIMFNPSIISKASIILASYFQDMDIDYVITVETKGVPLAYEVAKCLGVQLITARRD 163
gi 20139613   83 MVEDLRTKLSESDRILPGGYIYLSDLLSTPAILKNIGRIIAKSFMDQKIDAVMTVATKGVPLANAVANVLNVSFVIVRRD 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1P4A_A       163 NKVTEGSTVSINYVSGSS-NRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDER 241
gi 586880    163 NKVTEGSTVSINYVSGSS-NRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDER 241
gi 20517584  165 SRVTEGSFVSINYVSGSQ-RHIRSMSLARRALDKGAKVLLVDDFMKAGGTLKGMTELMEEFDAHVVGAGVMIATEEPREK 243
gi 499320435 164 SKVTEGSTVSINYVSGTS-GKIQQMCLSRKSLKQGSKCIFIDDFMRGGGTAKGLVDLLKEFDSELMGIGVLIDNKLSTNK 242
gi 20139613  163 LKITEGSTVSVNYVSGSSgDRIEKMFLSKRSLKAGSRVLIVDDFLKGGGTVNGMISLLREFDSELAGVAVFADNAQEERE 242
                        250       260
                 ....*....|....*....|....*....
1P4A_A       242 LVDEYMSLLTLSTINMKEKSIEIQNGNFL 270
gi 586880    242 LVDEYMSLLTLSTINMKEKSIEIQNGNFL 270
gi 20517584  244 LIDNYISIFVLKNVEEEKNIVEIEISDWI 272
gi 499320435 243 ITKDYVSLIDIVEINEDG-VKMVPSM--- 267
gi 20139613  243 KQFDYKSLLKVTNIDVKNQAIDVEVGNIF 271
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap