1BRM


Conserved Protein Domain Family
asd_gamma

?
TIGR01745: asd_gamma 
Click on image for an interactive view with Cn3D
aspartate-semialdehyde dehydrogenase, gamma-proteobacterial
[Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 130806
View PSSM: TIGR01745
Aligned: 4 rows
Threshold Bit Score: 725.928
Threshold Setting Gi: 17546706
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BRM_A         2 KNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTG-TLQDAFDLEALKALDIIVTCQGGDYTNE 80
gi 118510      2 KNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTG-TLQDAFDLEALKALDIIVTCQGGDYTNE 80
gi 499311148   1 MKVGLVGWRGMVGSVLMQRMQEEKDFDLIDTVFFSTSNAGGKAPSFAKTDA-PLADANDIDALKQCDTIITCQGGDYTTE 79
gi 11132302    3 KIVGLVGWRGMVGSVLLKRMQEENDFSRIKPVFFSTSQFGQDGPIINNISYnILENAYNIDVLKEMDIIITCQGGSYTKE 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BRM_A        81 IYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVAT 160
gi 118510     81 IYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVAT 160
gi 499311148  80 IFPKLRAAGWNGYWIDAASTLRMEDDAVIVLDPVNLQLIKDAVARGTKNFIGGNCTNSILLMGVGGLFRDGLVEWVSSMT 159
gi 11132302   83 IYPTLRKNGWKGYWIDAASNLRMKNDSVIILDPVNYNVIEDSINKGIRTFVGGNCTISLMLMSLGGLFQTELVEWIAVST 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BRM_A       161 YQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR 240
gi 118510    161 YQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR 240
gi 499311148 160 YQAASGGGANHMRELLKGMGVIHREVEEELASPASAILEIDRKVAKTIR-EDVPTEYFPAPLAGGLIPWIDKQLDNGQSK 238
gi 11132302  163 YQAASGAGARHMIELLNQMGILYKSVETDLLKGSHSILSIEDKVTKISRSVNFPVKNFSVPLAASLIPWIDTEMSNGQSR 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BRM_A       241 EEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITMRELTPAA 320
gi 118510    241 EEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITMRELTPAA 320
gi 499311148 239 EEWKGQAEVNKILGTARTIPVDGLCVRIGAMRCHSLGLTLKLKRDLPLEEIESIIRSGNPWVKWVPNERGITEQELTPAA 318
gi 11132302  243 EEWKGQAETNKILGTKDTILIDGTCVRIGSLRCHSQSFVIKLKKDVSLEDIEEIIRNHNKWVDVIPNSIQDTLLKLTPSS 322
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*..
1BRM_A       321 VTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQLA 367
gi 118510    321 VTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQLA 367
gi 499311148 319 ITGGLDIGVGRVRKLNMGPEYVSAFVIGDQLLWGAAEPLRRMLRILL 365
gi 11132302  323 VTGTLNIPIGRLRKLNMGKKYLSAFTVGDQLLWGAAEPLRRMLNILI 369
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap