4D9M


Conserved Protein Domain Family
diampropi_NH3ly

?
TIGR01747: diampropi_NH3ly 
Click on image for an interactive view with Cn3D
diaminopropionate ammonia-lyase family
This small subfamily includes diaminopropionate ammonia-lyase from Salmonella typhimurium and a small number of close homologs, about 50 % identical in sequence. The enzyme is a pyridoxal phosphate-binding homodimer homologous to threonine dehydratase (threonine deaminase). [Energy metabolism, Other]
Statistics
?
PSSM-Id: 130808
View PSSM: TIGR01747
Aligned: 4 rows
Threshold Bit Score: 692.019
Threshold Setting Gi: 385252036
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4D9M_A        23 LFSQSQAKLARQFHQKIAGYRPTPLCALDDLANLFGVKKILVKDESKRFGLNAFKMLGGAYAIAQLLCEKYHLDIETLSF 102
gi 2833403    23 LFSQSQAKLARQFHQKIAGYRPTPLCALDDLANLFGVKKILVKDESKRFGLNAFKMLGGAYAIAQLLCEKYHLDIETLSF 102
gi 488317755  21 LMSKEKIEKALAFHKSFPQYSETPLAELNHMAAYLGLNDFFVKDESYRFGLNAFKVLGGSFAMANYIAEKLKKDVSELTY 100
gi 17865702   24 LLNGNVGHEVLAFHKKLPNYAVTPLHNLAHLSQRLGLGSIHIKDESWRFGLNAFKGLGGSYAVGKYLADKLQCDINSLSF 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4D9M_A       103 EHLKN-AIGEKM---TFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQH 178
gi 2833403   103 EHLKN-AIGEKM---TFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQH 178
gi 488317755 101 DELTSdQLRSAFgqaTFFTATDGNHGRGVAWAANKLGQKSVVLMPKGSTQTRKENIEKEGATVTIEEVNYDECVRMANKM 180
gi 17865702  104 AALNTpEIKEKIkdcVFVTATDGNHGRGVAWAAEQLGLKAVVYMPKGSSLIRAENIRHHGAECTITDLNYDDAVRLAHRM 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4D9M_A       179 AQQHG-WEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMG-VTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSI 256
gi 2833403   179 AQQHG-WEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMG-VTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSI 256
gi 488317755 181 AEETEnGVMVQDTAWDGYEKIPTWIMQGYGTMALEASQQLRKFGsERPSHVFVQAGVGSLAGAVIGYFANAFPENPPIMV 260
gi 17865702  184 AQTKG-WVLLQDTAWTGYEEIPTWIMQGYMTLAVEAYEQLAETNsPLPTHLILQAGVGSFAGSVMGYFVEKMQENIPNII 262
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4D9M_A       257 IVEPDKADCIYRSGVK--GDIVNVGGDMATIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGN-DPR 333
gi 2833403   257 IVEPDKADCIYRSGVK--GDIVNVGGDMATIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGN-DPR 333
gi 488317755 261 VVEAQAADCLYQSAIKkdGEIRFVDGDLQTIMAGLACGEPNTISFDILKNHTSFFVSAPDWVSEKGMRMLGAPLKG-DPQ 339
gi 17865702  263 VVEPHQANCLYQSAVMddGQPHCVTGDMATIMAGLACGEPNIISWPIIRDNTSCFISADDCLAAKGMRISAAPRPGtDTP 342
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*...
4D9M_A       334 IISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWE 391
gi 2833403   334 IISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWE 391
gi 488317755 340 VVSGESGAVAMGLVATVMQDPDYQELHEALQLDETSNVLMFSTEGDTDPDNYKKILWR 397
gi 17865702  343 FISGESGAIGVGLLYELMNNMHYQDLANRLQLDASAHVLLISTEGDTSPDIYEDIVWN 400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap