4B8U,1MKB


Conserved Protein Domain Family
fabA

?
TIGR01749: fabA 
Click on image for an interactive view with Cn3D
beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA
This enzyme, FabA, shows overlapping substrate specificity with FabZ with regard to chain length in fatty acid biosynthesis. It is commonly designated 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.60) as if it were specific for that chain length, but its specificity is broader; it is active even in the initiation of fatty acid biosynthesis. This enzyme can also isomerize trans-2-decenoyl-ACP to cis-3-decenoyl-ACP to bypass reduction by FabI and instead allow biosynthesis of unsaturated fatty acids. FabA cannot elongate unsaturated fatty acids. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 130810
View PSSM: TIGR01749
Aligned: 7 rows
Threshold Bit Score: 330.993
Threshold Setting Gi: 21362553
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4B8U_A        3 KQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLG 82
gi 23821539   3 RQNAYSRDQLLASARGELFGPNSGRLPNDPMLMFDRITEINDNGGSHGKGLIRAELDIRPDLWFFNCHFIGDPVMPGCLG 82
gi 14423690   3 KQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLG 82
gi 1706748    4 KRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLG 83
gi 21362559   2 QKNAYTFEELLACGRGEMFGPGNAQLPAPPMLMFDRIVRIEAEGGKYGKGYVEAEFDIRPDLWFFDCHFIGDPVMPGCLG 81
gi 21362553   4 QKSSYGYEELLACGRGEMFGPGNAQLPLPPMLMIHRITEISETGGAFDKGYIRAEYDVRPDDWYFPCHFQGNPIMPGCLG 83
1MKB_A        3 KRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLG 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4B8U_A       83 LDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRV 162
gi 23821539  83 LDAMWQLTGFFLTWIGAPGRGRALGCGEVKFTGQVLPTATLVTYEIEISRVINRKLVMAQSDARMLVDGREIYAAKDLRV 162
gi 14423690  83 LDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRV 162
gi 1706748   84 LDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKV 163
gi 21362559  82 LDAMWQLVGFFLGWSGGPGRGRALGVGEVKFTGQVTPDIKKVVYKIDLKRVIMRKLVMGIADGVLEADGKVIYETSDLKV 161
gi 21362553  84 LDGMWQLTGFFLGWLGEPGRGMALSTGEVKFKGMVRPHTKLLEYGIDFKRVMRGRLVLGTADGWLKADGELIYQATDLRV 163
1MKB_A       83 LDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKV 162

                ....*....
4B8U_A      163 GLFTSTDSF 171
gi 23821539 163 GMFTSTENF 171
gi 14423690 163 GLFTSTDSF 171
gi 1706748  164 GLFQDTSAF 172
gi 21362559 162 GLFTPEQMA 170
gi 21362553 164 GLSKEGSAQ 172
1MKB_A      163 GLFQDTSAF 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap