1U1Z,2GLL,4I83


Conserved Protein Domain Family
fabZ

?
TIGR01750: fabZ 
Click on image for an interactive view with Cn3D
beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ
This enzyme, FabZ, shows overlapping substrate specificity with FabA with regard to chain length in fatty acid biosynthesis. FabZ works preferentially on shorter chains and is often designated (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase, although its actual specificity is broader. Unlike FabA, FabZ does not function as an isomerase and cannot initiate unsaturated fatty acid biosynthesis. However, only FabZ can act during the elongation of unsaturated fatty acid chains. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 130811
View PSSM: TIGR01750
Aligned: 15 rows
Threshold Bit Score: 207.554
Threshold Setting Gi: 20138292
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U1Z_A       23 DINEIREYLPHRYPFLLVDRVVELDieGKRIRAYKNVSINEPFFNGHFPEHPIXPGVLIIEAXAQAAGILGFKXLDV--- 99
gi 14423703   3 DIQGIKEALPHRYPMLLVDRVLEVS--EDTIVAIKNVTINEPFFNGHFPQYPVMPGVVIMEALAQTAGVLELSKPEN--- 77
gi 14423712   8 GIQDIQNLLPHRYPFLLVDKILSYDlnTRSIVAQKNVTINEPFFVGHFPEAPIMPGVLILEALAQAAGVLLGIILEN--- 84
gi 14423695  25 TIQEISDLLPHRYPFALVDRIIDFQp-GKCAVGLKNVTINEPFFPGHIPDRPIMPGVLIVESMAQVGGVIL-TQLPG--- 99
gi 14423705   8 EAKDIQKLIPHRYPFLQLDRITAFEp-MKTLTAIKNVTINEPQFQGHFPDLPVMPGVLIIEAMAQACGTLAILSEGG--- 83
gi 14423716  15 DVKRVMAALPHRFPMLLVDRVETLIp-GEKIVAIKAVTINEPFFTGHFPGNPIMPGVLIVEALAQAAGVLAIESLG---- 89
gi 14423718  13 FIEHILQILPHRYPMLLVDRIIELQa-NQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEGMAQTGGFLAFTSLWGfdp 91
gi 20138307  11 DIMGLMKLLPHRYPFLMIDRIIDIDg-DDSAIGIKNVTINEPHFQGHFPEQPVMPGVLIVEAMAQTAGAICIRSLG---- 85
gi 20138292   4 SIEQIMEIIPHRYPMLLVDRVEEIEp-GKRAVGYKNVTFNEQIFQGHYPGKPIMPGVLMIEALAQLGG-VAILSLD---- 77
2GLL_A       25 FIEHILQILPHRYPMLLVDRITELQa-NQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEGMAQSGGFLAFTSLWGfdp 103
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
1U1Z_A      100 KPADgTLYYFVGSDKLRFRQPVLPGDQLQLHAKFI-SVKRSIWKFDCHATVDDKPVCSAEIICAE 163
gi 14423703  78 KGK---LVFYAGMDKVKFKKQVVPGDQLVMTATFV-KRRGTIAVVEAKAEVDGKLAASGTLTFAI 138
gi 14423712  85 DRDK-KIALFLGIQKAKFRQPVKPGDVLILKAEFS-LISAKGGKAIAQAFVGSQIVAEGELSFVL 147
gi 14423695 100 MRG--KFFAFAGIDGVRFRRPVVPGDQLIMTVELQsFKLQRIAKMQGEARVDGQLVCGGEMLFSL 162
gi 14423705  84 RKEN-EFFFFAGIDEARFKRQVIPGDQLVFEVELL-TSRRGIGKFNAVAKVDGQVAVEAVIMCAK 146
gi 14423716  90 LTGTgKLVYFMAINETKFRIPVEPGILLRLEVEFL-QKRAKICKFKARALIEDKVAAETEFTAMI 153
gi 14423718  92 EIAKtKIVYFMTIDKVKFRIPVTPGDRLEYHLEVL-KHKGMIWQVGGTAQVDGKVVAEAELKAMI 155
gi 20138307  86 -ASKpSLVYFLTIDNAKFRKPVVPGDQLKIHVKKI-KKRGNLLKFACEALVDGTKAAEAEISAMM 148
gi 20138292  78 -KYKgKKPILGAVKNAKFRRMVVPGDVLKLEIEIV-KVKGPAGIGKGIATVNGEKAVEAEITFMI 140
2GLL_A      104 EIAKtKIVYFMTIDKVKFRIPVTPGDRLEYHLEVL-KHKGMIWQVGGTAQVDGKVVAEAELKAMI 167
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap