Conserved Protein Domain Family
flav_RNR

?
TIGR01754: flav_RNR 
ribonucleotide reductase-associated flavodoxin, putative
This model represents a family of proteins found immediately downstream of ribonucleotide reductase genes in Xyella fastidiosa and some Gram-positive bacteria. It appears to be a highly divergent flavodoxin of the short chain type, more like the flavodoxins of the sulfate-reducing genus Desulfovibrio than like the NifF flavodoxins associated with nitrogen fixation.
Statistics
?
PSSM-Id: 130815
View PSSM: TIGR01754
Aligned: 3 rows
Threshold Bit Score: 242.474
Threshold Setting Gi: 23100543
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499196168   1 MRILLALASLSGNTREVARIIRARCEERGHRVdwIETDLQTLAGQALDpRTYTLFLLGTWTDNAGRTPFEMKRFIAELLE 80
gi 499298957   1 MRILLAYDSLSGNTKMVADEIEEILISEGHEV--VSFRVSPLAEYPLD-EDFDLYVLGAWTVDYGRTPPDMKDFIAELAV 77
gi 499379914   1 MRMIIAYLTYSGNTEEVAFMIQDYLQKDGVEVd--LHRIG--IDAPFHpENYDLVFLGTFTWERGATPDEVKDFVWEIGY 76
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 499196168  81 ligKPPSVAVFGTGETQW-GQEYYCGAVHRVADFFSSRFPRLLIEQMPHGERDGRAIAEWIDQVL 144
gi 499298957  78 ---KPKNVAIFGTGETQW-GMDFYCGAVDRMAKYFGTSYPTLKIEQMPHTEQDVADIDNWVRKIL 138
gi 499379914  77 ---KPSNMVIFGTGDTQFgGDDLFCKAVDKLSHFYGSSHPVLKIEQSPRGYQQ-RAVYDWLEGVL 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap