Conserved Protein Domain Family
Malate-DH_plant

?
TIGR01757: Malate-DH_plant 
malate dehydrogenase, NADP-dependent
This model represents the NADP-dependent malate dehydrogenase found in plants, mosses and green algae and localized to the chloroplast. Malate dehydrogenase converts oxaloacetate into malate, a critical step in the C4 cycle which allows circumvention of the effects of photorespiration. Malate is subsequenctly transported from the chloroplast to the cytoplasm (and then to the bundle sheath cells in C4 plants). The plant and moss enzymes are light regulated via cysteine disulfide bonds. The enzyme from Sorghum has been crystallized.
Statistics
?
PSSM-Id: 130818
View PSSM: TIGR01757
Aligned: 3 rows
Threshold Bit Score: 786.474
Threshold Setting Gi: 19069739
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19069739  27 VVRAVAAPVAPAAEAEAKK-AYGVFRLSYDTQNEDAslTRSWKKTVKVAVTGASGNIANHLLFMLASGEVYGKDQPIALQ 105
gi 126893    44 AAKQVQDGVATAEAPATRKdCFGVFCTTYDLKAEDK--TKSWKKLVNIAVSGAAGMISNHLLFKLASGEVFGQDQPIALK 121
gi 11182080  16 AALSVRAAAGAEVAAASKS--YGVFKLSYSIDNEPKqrTQSWKATINVVVSGAAGQISNHLLFMLASGSVFGNDQPIALR 93
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19069739 106 LLGSERSKEALEGVAMELEDSLYPLLREVSIGTDPYEVFGDADWALMIGAKPRGPGMERADLLQQNGEIFQVQGRALNES 185
gi 126893   122 LLGSERSFQALEGVAMELEDSLYPLLREVSIGIDPYEVFEDVDWALLIGAKPRGPGMERAALLDINGQIFADQGKALNAV 201
gi 11182080  94 LLGSERSKEALEGVAMELEDSLYPLLREVVIGIDPLEVFAEADWALLIGAKPRGPGMERADLLDINGRIFVDQGQALNRV 173
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19069739 186 ASRNCKVLVVGNPCNTNALIAMENAPNIPRKNFHALTRLDENRAKCQLALKSGKFYTSVSRMAIWGNHSTTQVPDFVNAR 265
gi 126893   202 ASKNVKVLVVGNPCNTNALICLKNAPDIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAK 281
gi 11182080 174 AKKTCKVLVVGNPCNTNALIAMLNAPNIPRKNFHALTRLDENRAKCQLALKSGKFYTSVTNVTIWGNHSTTQVPDFVNAK 253
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19069739 266 IGGLPAPDVIRDMKWFREEFTPKVALRGGALIKKWGRSSAASTAVSVADAIRALVVPTAPGDCFSTGVISDGNPYGVREG 345
gi 126893   282 IDGRPVKEVIKDTKWLEEEFTITVQKRGGALIQKWGRSSAASTAVSIADAIKSLVTPTPEGDWFSTGVYTTGNPYGIAED 361
gi 11182080 254 IGGKPATSVITDTAYLKEKFTPLVQTRGGALIKKWGRSSAASTAVSIADAIKSLVVPTPAGDWFSTAVCTDGNPYGIQEG 333
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19069739 346 LIFSFPCRSKGDGDYEICDNFIVDEWLRAKIRASEDELQKEKECVSHLIGMMGGSCALRgaEDTTVPGEN 415
gi 126893   362 IVFSMPCRSKGDGDYELATDVSMDDFLWERIKKSEAELLAEKKCVAHLTGEGNAYCDVP--EDTMLPGEV 429
gi 11182080 334 LVFSMPCRSTGDGDYEVVPGLVIDDYLREALRKTEDELVKEKECVGHLIGNPDAACAIT--EDTMLAGEN 401
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap