2FCT


Conserved Protein Domain Family
chlorin-enz

?
TIGR01762: chlorin-enz 
Click on image for an interactive view with Cn3D
chlorinating enzyme
This model represents a a group of highly homologous enzymes related to dioxygenases which chlorinate amino acid methyl groups. BarB1 and BarB2 are proposed to trichlorinate one of the methyl groups of a leucine residue in the biosynthesis of barbamide in the cyanobacterium Lyngbya majuscula. SyrB2 is proposed to chlorinate the methyl group of threonine in the biosynthesis of syringomycin in Pseudomonas syringae. CmaB is proposed to chlorinate the beta-methyl group of alloisoleucine in the process of ring closure in the biosynthesis of coronamic acid, a component of coronatine also in Pseudomonas syringae.
Statistics
?
PSSM-Id: 130823
View PSSM: TIGR01762
Aligned: 4 rows
Threshold Bit Score: 544.109
Threshold Setting Gi: 23452292
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FCT_A         8 FALTAEQRASFEKNGFIGPFDAYSPEEMKETWKRTRLRLLDRSAAAYQdldaisggTNIANYDRHLDDDFLASHICRPEI 87
gi 23452292   11 YYLSVEEKQFFRDNGYIGPFTLFQPEEILELWNEIRMDLLDRETAPFP--------NSKMNYDRHLDIQALSDIISHPKI 82
gi 492568438   6 FSLTKQELQQFDRDGFIGPFTLYEPEEMKQMHKTIRAQLFNRTHAPYDap----ldVAITNYDRHLDVDLLTSHVFRKEI 81
gi 5748808     5 FALTAEQRASFEKNGFIGPFDAYSPEEMKETWKRTRLRLLDRSAAAYQdldaisggTNIANYDRHLDDDFLASHICRPEI 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FCT_A        88 CDRVESILGPNVLCWRTEFFPKYPGDEGTDWHQADTFANASGKPQIIWPENEEFGGTITVWTAFTDANIANGCLQFIPGT 167
gi 23452292   83 AHRVSSLLGSNVLCWRTAWFPKYPGDEGTDWHQAESFVEFEGKSKLVPTESHDGPWELTAWVAFSEATRENGCMKVMPGT 162
gi 492568438  82 VHRVRSILGPDVICWRSEFIPKYPGNEGTDWHQADTFAHASGEPQLVWPEGEPFGGAINVWTGFTDATQENGCMQFIPGS 161
gi 5748808    85 CDRVESILGPNVLCWRTEFFPKYPGDEGTDWHQADTFANASGKPQIIWPENEEFGGTITVWTAFTDANIANGCLQFIPGT 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FCT_A       168 QNSMNYDETKRMTYEPDANNSVVKDGVRRGFFGYDYRQLQIDENWKPDEASAVPMQMKAGQFIIFWSTLMHASYPHSGES 247
gi 23452292  163 HNTWYFDEHRNIEFEPDKINQKLTGGKKTGVYGYDYYKLKLDPNWEPDESQAVHLEMEPGQFILFTSRCMHGSEPNTSGS 242
gi 492568438 162 HKQMNYDETRGMTFDPVTNNNVVKGQYPRGFNGYDYTTLQKDKSWKPDEASAVPIVMKAGQFVIFRSMLMHSSLPNSTPD 241
gi 5748808   165 QNSMNYDETKRMTYEPDANNSVVKDGVRRGFFGYDYRQLQIDENWKPDEASAVPMQMKAGQFIIFWSTLMHASYPHSGES 244
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|...
2FCT_A       248 QeMRMGFASRYVPSFVHVYPDSDHIEEYGGRISLEKYGAVQVIGDETPEYNRL 300
gi 23452292  243 S-IRYGWSTRFVPTDVRVYPDWESFQHFGEVFPLERYATVLVAGEDTYKHNKI 294
gi 492568438 242 K-TRLGYVARYVPGRVKVYPDTDYVKEFGGEYRLDRFGVVQVSGTTTDPKNRV 293
gi 5748808   245 QeMRMGFASRYVPSFVHVYPDSDHIEEYGGRISLEKYGAVQVIGDETPEYNRL 297
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap