Conserved Protein Domain Family
carotene-cycl

?
TIGR01790: carotene-cycl 
lycopene cyclase family protein
This family includes lycopene beta and epsilion cyclases (which form beta and delta carotene, respectively) from bacteria and plants as well as the plant capsanthin/capsorubin and neoxanthin cyclases which appear to have evolved from the plant lycopene cyclases. The plant lycopene epsilon cyclases also transform neurosporene to alpha zeacarotene.
Statistics
?
PSSM-Id: 130850
View PSSM: TIGR01790
Aligned: 7 rows
Threshold Bit Score: 435.707
Threshold Setting Gi: 11135921
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11132841 107 DLVVIGCGPAGLALAAESA--KLGLNVGLVG--PD-LPFTNNYGVWEDEFKDLG---LQACIEHVWRDTIVYLDDdEPIL 178
gi 11133036   3 DALVIGSGPAGLAIAAELA--QRGLKVQGLSpvDPfHPWENTYGIWGPELDSLG---LEHLFGHRWSNCVSYFGE-APVQ 76
gi 11135921  10 DVLVIGGGPSGTALSAELA--ARGLDVQQLAphPP-RPFPATYGAWLGDLPTWA---RG-CAEQVWTDVRAYTGP-QPTS 81
gi 11133022  85 DLAVVGGGPAGLAVAQQVS--EAGLSVCSIDpnPK-LIWPNNYGVWVDEFEAMD---LLDCLDATWSGAAVYIDDnTAKD 158
gi 148396     6 DLILVGAGLANGLIALRLQqqQPDMRILLIEaaPQ-AGGNHTWSFHDADLTESQhrwVAPLVVYHWPD-YQVRFPtRRRK 83
gi 8650416    6 DVIVIGGGLAGCLIALRLTdaRPDLRVVIIEgsAS-IAGNHTWSFFGTDISSDQhawLGRLVGHRWPG-YEVRFAeHAIR 83
gi 2130969   16 DCAIVGGGLAGGLIALALQraRPEFRIRVIEagRT-IGGNHRWSWFDSDLSDAGralLADFRQTDWEGGYEVRFPkYRRK 94
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11132841 179 IGRAYGRVSRHFLHEELLKRCVEAGVLYLNSKVDRIVEAtNGQSLVECEGDVVIPCRFVTVASGAASgkFLQYELGSPRV 258
gi 11133036  77 HQYNYGLFDRAQLQQHWLRQCEQGGLQWQLGKAAAIAHD-SHHSCVTTAAGQELQARLVVDTTGHQA--AFIQRPHSDAI 153
gi 11135921  82 LGQPYALLDNAALLRTLRGLAD---WTWVEGAALHAERS-GAGWTVYGAGGERWQTRLVVDASGHGA--LVSPVRFPGGA 155
gi 11133022 159 LHRPYGRVNRKQLKSKMMQKCIMNGVKFHQAKVIKVIHE-ESKSMLICNDGITIQATVVLDATGFSRs-LVQYDK-PYNP 235
gi 148396    84 LNSGYFSVTSQRFAEVLQQKFGQH--LWISRAVAEVHADaVRLN-----NGQVISASAVIDGRGYTP-------NSALNV 149
gi 8650416   84 LSTAYLSMTSTRLRAEVEQRFPER--ILRDATAISATADhVVLE-----GGRTLRAPCVIDARGGRP-------VPGLAL 149
gi 2130969   95 LKTAYRSMASTDFHEGLLRALPEGs-VILGRKAVGLDARgVDLAPSQYGPATRINARSVIDCRSFKP-------SAHLKG 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11132841 259 SVQTAYGVEVEVDNNPFDPSLMVFMDYRDYLRhdAQSLEAKY---PTFLYAMPMSPTRVFFEETCLASKDAMPFDLLKKK 335
gi 11133036 154 AYQAAYGIIGQFSQPPIEPHQFVLMDYRSDHL--SPEERQLP---PTFLYAMDLGNDVYFVEETSLAACPAIPYDRLKQR 228
gi 11135921 156 ALQTAYGVVARFRRPPVTPGSMVWMDYRTP----APELKRGE---ATFLYAMHLGGDRYFVEETSLIARPAPTRAELRRR 228
gi 11133022 236 GYQVAYGILAEVEEHPFDVNKMVFMDWRDSHLknNTDLKERNsriPTFLYAMPFSSNRIFLEETSLVARPGLRIDDIQER 315
gi 148396   150 GFQAFIGQEWRLS-KPHGLSSPIIMDATVDQQn------GYR-----FVYSLPLSATELLIEDTHYIDNATLEPERARQN 217
gi 8650416  150 GFQKFLGLEVRLA-APHGLDVPIVMDATVAQSd------GYR-----FVYTLPLDPQRLLIEDTYYSDGGELPEQVLHQR 217
gi 2130969  167 GWQVFLGRHMRLQ-EPHGVENPVIMDATVDQLapHGNGGSYR-----FVYVLPLGSHDVFIEDTYYADDPLLDRNALSGR 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11132841 336 LMLRLNTLGVRIKEIYEEEWSYIPVGGSLPN----TEQK---TLAFGAAASMVHPATGYSVVRSLSEAPKCASVLANILR 408
gi 11133036 229 LYQRLATRGVTVQVIQHEEYCLFPMNLPLPD----LTQS---VVGFGGAASMVHPASGYMVGALLRRAPDLANAIAAGLN 301
gi 11135921 229 LLARLSAQGTPPHATESEEWVAFPMNAQAP-----APGG---VLAYGAAAGRVHPVSGFQVAGALSDAPGVATAIATALC 300
gi 11133022 316 MVARLNHLGIKVKSIEEDEHCLIPMGGPLPV----LPQR---VVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLG 388
gi 148396   218 IRDYAAQQDWQLQTLLREEQGALPITLTGDStafwQQQP---LACSGLRAGLFHPTTGYSLPLAVALADRLSALD----V 290
gi 8650416  218 IARYALAKGWQIAEIIRAEQGVLPVILAGDPsglvSKPDs--PPRVGLAALLVHPTTGYSLPDAVRVADLLTARLAQRGA 295
gi 2130969  241 IDQYARANGWENGTPVHHEAGVLPVLTGGDFsayqDEVRipgVAIAGARGGFTHPLTSYTMCVAVENALAMAEQP----D 316
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11132841 409 QHYsknmltsssipSISTQAWNTLWPQERKRQRSFFLFGLALILQLDIEGIRSFFRAFFRVPKWMWQGFLGSSLSSADLM 488
gi 11133036 302 ASSslt------taELATQAWRGLWPTEKIRKHYIYQFGLEKLMRFSEAQLNHHFQTFFGLPKEQWYGFLTNTLSLPELI 375
gi 11135921 301 QGK-----------DAAAAGWAALWSPERRAAREVHLLGVGALLGLERAELPHFFGTFFGLPREQWARFLHPDTDAGTLA 369
gi 11133022 389 SERshs------gnELSTAVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELI 462
gi 148396   291 FTS-----------SSIHQAITHFAHERWQQQRFFRMLNRMLFLAGPADSRWRVMQRFYGLPEDLISRFYAGKLTLTDRL 359
gi 8650416  296 LSS-----------ADARETIDGYGRTIWRRRGYYRFLNRMLFKAAEPSERHRILARFYGLDQALIERFYAARIQPQDKL 364
gi 2130969  317 LSG-----------EQLAAFFDSRARRHWSKTGYYRLLARFLFFAAKPEKRVKVFQRFYGLREGLIERFYAARSNTFDKV 385
                       410
                ....*....|....*...
gi 11132841 489 LFAFYMFIIAPNDMRKGL 506
gi 11133036 376 QAMLRLFAQAPNDVRWGL 393
gi 11135921 370 RTMLRVFAQTGGRVRLPL 387
gi 11133022 463 VFGLSLFSHASNTSRFEI 480
gi 148396   360 RILS---GKPPVPVLAAL 374
gi 8650416  365 RVFMHMLMKPPIPISSAL 382
gi 2130969  386 RVLW---GEPPVAIHSAI 400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap