Conserved Protein Domain Family
cit_synth_euk

?
TIGR01793: cit_synth_euk 
citrate (Si)-synthase, eukaryotic
This model includes both mitochondrial and peroxisomal forms of citrate synthase. Citrate synthase is the entry point to the TCA cycle from acetyl-CoA. Peroxisomal forms, such as SP:P08679 from yeast (recognized by the C-terminal targeting motif SKL) act in the glyoxylate cycle. Eukaryotic homologs excluded by the high trusted cutoff of this model include a Tetrahymena thermophila citrate synthase that doubles as a filament protein, a putative citrate synthase from Plasmodium falciparum (no TCA cycle), and a methylcitrate synthase from Aspergillus nidulans.
Statistics
?
PSSM-Id: 130853
View PSSM: TIGR01793
Aligned: 3 rows
Threshold Bit Score: 851.494
Threshold Setting Gi: 8928010
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146345393  39 TKSLKETFADKLPGELEKVKKLRKEHGNKVIGELTLDQAYGGARGVKCLVWEGSVLDSEEGIRFRGLTIPECQKLLPKAP 118
gi 461743     32 STNLKEVLSKKIPAHNAKVKSFRTEHGSTVVQNVNIDMIYGGMRSMKGMVTETSVLDPEEGIRFRGYSIPECQKLLPKAK 111
gi 8928010    38 DLDLRSQLKELIPEQQERIKKLKAEHGKVQLGNITVDMVLGGMRGMTGLLWETSLLDPEEGIRFRGLSIPECQKLLPGAK 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146345393 119 GGEEPLPEGLFWLLLTGEVPSEQQVRDLSAEWAARSDLPKFIEELIDRCPSTLHPMAQFSLAVTALEHESAFAKAYAKGI 198
gi 461743    112 GGEEPLPEAIWWLLCTGDVPSEAQTAAITKEWNARADLPTHVVRMLDNFPDNLHPMAQFIAAIAALNNESKFAGAYARGV 191
gi 8928010   118 PGGEPLPEGLLWLLLTGKVPTKEQVDALSAELRSRAAVPEHVYKTIDALPVTAHPMTQFATGVMALQVQSEFQKAYEKGI 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146345393 199 NKKEYWHYTFEDSMDLIAKLPTIAAKIYRNVFKDGKV-APIQKDKDYSYNLANQLGFaDNKDFVELMRLYLTIHSDHEGG 277
gi 461743    192 AKASYWEYAYEDSMDLLAKLPTVAAIIYRNLYRDGSAvSVIDPKKDWSANFSSMLGY-DDPLFAELMRLYLVIHSDHEGG 270
gi 8928010   198 HKTKYWEPTYEDSITLIAQLPVVAAYIYRRMYKNGQS-ISTDDSLDYGANFAHMLGY-DSPSMQELMRLYVTIHTDHEGG 275
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146345393 278 NVSAHTTHLVGSALSSPMLSLAAGLNGLAGPLHGLANQEVLNWLTEMKKVVGNdLSDQSIKDYLWSTLNAGRVVPGYGHA 357
gi 461743    271 NVSAHTSHLVGSALSDPYLSFSAAMAGLAGPLHGLANQEVLVFLNKIVGEIGFnYTEEQLKEWVWKHLKSGQVVPGYGHA 350
gi 8928010   276 NVSAHTGHLVASALSDPYLSFAAALNGLAGPLHGLANQEVLLWIKSVVSECGEnVTKEQLKDYIWKTLNSGKVVPGYGHG 355
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146345393 358 VLRKTDPRYTSQREFALRKLPDDPMFKLVSQVYKIAPGVLTEHGKTKNPYPNVDAHSGVLLQYYGLTEANYYTVLFGVSR 437
gi 461743    351 VLRKTDPRYECQREFALKHLPNDDLFKLVSTLYKITPGILLEQGKAKNPWPNVDSHSGVLLQYFGMTEMSFYTVLFGVSR 430
gi 8928010   356 VLRNTDPRYICQREFALKHLPDDPLFQLVSNLFEVVPPILTELGKVKNPWPNVDAHSGVLLNHYGLTEARYYTVLFGVSR 435
                        410       420
                 ....*....|....*....|....*....
gi 146345393 438 ALGVLPQLIIDRAFGAPIERPKSFSTEAY 466
gi 461743    431 ALGCLSQLIWARGMGLPLERPKSHSTDGL 459
gi 8928010   436 AIGICSQLVWDRALGLPLERPKSVTMEWL 464
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap