Conserved Protein Domain Family
CM_mono_cladeE

?
TIGR01795: CM_mono_cladeE 
monofunctional chorismate mutase, alpha proteobacterial type
This model represents a small clade of monofunctional (non-fused) chorismate mutases spanning alpha proteobacteria and two actinobacter gram positive species. The alpha proteobacterial members are trusted because the pathways of CM are evident and there is only one plausible CM in the genome. In S. coelicolor, however, there is another aparrent monofunctional CM. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130854
View PSSM: TIGR01795
Aligned: 3 rows
Threshold Bit Score: 145.868
Threshold Setting Gi: 225628376
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23325595   27 AVARIKALRQTIDNIDSAVIALLAERFKATSQVGVLKANAGFAPEDTKREDYQIERLHRIAIDAGLDPEIAEMYREFVVT 106
gi 490074622  15 VREELARLRDSIDNIDAAVVHMLAERFKCTQQVGHLKARHQLPPADPAREAQQIARLRTLAESAKLDPAFAEKFLNFIVA 94
gi 642987083  11 IPAELLALRASIDNIDAALIHMLAERFRCTKAVGVLKAERGLAPADPAREKRQVARLRALAADANLDPDFAEKFLNFIVK 90
                         90
                 ....*....|....
gi 23325595  107 EAKKRHQRIADAGG 120
gi 490074622  95 EVIHHHERIAESNA 108
gi 642987083  91 EVIRHHEHTAANHG 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap