1ECM


Conserved Protein Domain Family
CM_P_1

?
TIGR01797: CM_P_1 
Click on image for an interactive view with Cn3D
chorismate mutase domain of proteobacterial P-protein, clade 1
This model represents the chorismate mutase domain of the gamma and beta proteobacterial "P-protein" which contains an N-terminal chorismate mutase domain and a C-terminal prephenate dehydratase domain. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130856
View PSSM: TIGR01797
Aligned: 4 rows
Threshold Bit Score: 118.381
Threshold Setting Gi: 1311033
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ECM_A        7 LLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLITLG--KAHHLDAHYITRLFQLIIEDS 84
gi 130050     7 LLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLITLG--KAHHLDAHYITRLFQLIIEDS 84
gi 11386975   7 LLIFRDEINNIDKKIVKLLAERKNLVFKIAQSKIENNQAIRDIEREKKMLQKLIFLG--KKYNLKSEYITQLFQLIIEES 84
gi 1172476    5 LSDIRQQITQIDRSLLKLLSERHRLAFDVVRSKEISQKSLRDVEREQQLLQELVQFAenENYQLEAQYITSIFQKIIEDS 84

                ....*
1ECM_A       85 VLTQQ 89
gi 130050    85 VLTQQ 89
gi 11386975  85 VATQK 89
gi 1172476   85 VLTQQ 89
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap