Conserved Protein Domain Family
CM_T

?
TIGR01799: CM_T 
chorismate mutase domain of T-protein
This model represents the chorismate mutase domain of the gamma proteobacterial "T-protein" which consists of an N-terminal chorismate mutase domain and a C-terminal prephenate dehydrogenase domain. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130858
View PSSM: TIGR01799
Aligned: 3 rows
Threshold Bit Score: 151.588
Threshold Setting Gi: 136592
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136592      5 LTALRDQIDEVDKALLNLLAKRLELVAEVGEVKSRFGLPIYVPEREASMLASRRAEAEALGVPPDLIEDVLRRVMRESYS 84
gi 1174832     7 LKDLRSEIDSLDRELIQLFAKRLELVSQVGKVKHQHGLPIYAPEREIAMLQARRLEAEKAGISADLIEDVLRRFMRESYA 86
gi 499384003   9 LEHLRGLIDGVDQQLLHLLRKRLDLVAQVGTVKHAAGLPIYAPQREAAMLAKRREEAQTMGIAPQLIEDILRRLMRESYL 88

                 ...
gi 136592     85 SEN 87
gi 1174832    87 NEN 89
gi 499384003  89 NEK 91
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap