2F6L


Conserved Protein Domain Family
CM_mono2

?
TIGR01806: CM_mono2 
Click on image for an interactive view with Cn3D
chorismate mutase, putative
This model represents a clade of probable chorismate mutases from alpha, beta and gamma proteobacteria as well as Mycobacterium tuberculosis and a clade of nematodes. Although the most likely function for the enzymes represented by this model is as a chorismate mutase, in no species are these enzymes the sole chorismate mutase in the genome. Also, in no case are these enzymes located in a region of the genome proximal to any other enzymes involved in chorismate pathways. Although the Pantoea enzyme has been shown to complement a CM-free mutant of E. coli, this was also shown to be the case with isochorismate-pyruvate lyase which only has a secondary (non-physiologically relevant) chorismate mutase activity. This enzyme is believed to be a homodimer and be localized to the periplasm. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130865
View PSSM: TIGR01806
Aligned: 8 rows
Threshold Bit Score: 111.751
Threshold Setting Gi: 386061360
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2F6L_A         1 DGTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRF 80
gi 1168941    23 VSSVSLGSLSSALNERMQVMKAVAGYKALHHLPIEDLPREQVVLDHMLQNAQQAGLEPHSVEPFVHALMNASKTIQYRYR 102
gi 5353514    25 DTNADIDRFVEIADDRLTLSDYVALYKIVNNQSITDPKREEKLLDDMRSKGKNLSLSEDYVTLIFQDQINASKYFQNYLV 104
gi 488140158  28 VQAQQCGQTAPLINERLSYMKDVAGYKAENHLPIEDRIQEEKVINSAMAQAESLGLNGESIKPLMVAQINAAKAIQYRYR 107
gi 620856167  34 DGTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRF 113
gi 489579567  29 rsqPPLDLLMDRIVQRNAIGDAVALSKWDSGKPVLDQAREAAVLQSVRDQAPAHGLDADDAARFFGAQIEANKSVQYALL 108
gi 686117547  22 PLSPALQQLLSLSSQRLQLADQVAQSKAQSGKAVQDSPREEQQLQMLAGQAGSHGVGAEQVRLLFAAQIEANKLVQYRLL 101
gi 21686551   91 TQGTATLFIVGVANKRLMLAKDVVNYKFHQNISIDDFEREKQVLESVSAQGQKAGIGDNYGEKFFQDQMDANKMIQKGSV 170
                         90       100       110
                 ....*....|....*....|....*....|....*..
2F6L_A        81 SDWkL-NPASAPPEPPDLS-ASRSAIDSLNNRMLSQI 115
gi 1168941   103 ADW-L-SSPDSAVPVRDLT-ETRQQIQQLDTQLLTAI 136
gi 5353514   105 NLW-N-QTGIPPIKVRNLNtDLRPAIDQINTEMLQLL 139
gi 488140158 108 ADW-L-SQPEPGWQPKPLD-DVRANIGELSTKILEQI 141
gi 620856167 114 SDWkL-NPASAPPEPPDLS-ASRSAIDSLNNRMLSQI 148
gi 489579567 109 NRW-ReRGRAPNTARPDLT-ALRARLDQLQGELLDAL 143
gi 686117547 102 S-----RPLPDAGQAVDLE-RIRSRLNQLNLELLRGY 132
gi 21686551  171 KLW-TaNKSLPPQNVPDLQkDTRPKVTAATEEMILAL 206
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap