Conserved Protein Domain Family
TrpE-clade3

?
TIGR01815: TrpE-clade3 
anthranilate synthase, alpha proteobacterial clade
This model represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium). This enzyme is the first step in the pathway for the biosynthesis of tryprophan from chorismate. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130874
View PSSM: TIGR01815
Aligned: 3 rows
Threshold Bit Score: 1252.48
Threshold Setting Gi: 1717765
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136328     13 YTTKGGIVVTRRRREASYSDAIAGYVDRLDERRGAVFSSNYEYPGRYTRWDTAVVDPPLAISSFGRSLWIEAYNERGEVL 92
gi 1717765    18 FQTRGGVTVTRRATALDPRTALDPVIDALDRRRGLLLSSGVEAPGRYRRHALGFTDPAVALTARGRTLRIDALNGRGQVL 97
gi 499303815   8 YRTNGNVRVSRSITQVKMETALEEILFYLNSQRGGLLTSSYEYPGRYKRWAIGFVNPPVELSTSGNTFTLTALNERGYVL 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136328     93 LALIAEDLKSVADITLGSLAARRLDLTINEPdRVFTEEERSKMPTVFTVLRAVTNLFHSEEDSNLGLYGAFGYDLAFQFD 172
gi 1717765    98 LPAVAEALRGLEALAGLEEAPSRVTASSASP-APLPGEERSRQPSVFSVLRAVLDLFAAPDDPLLGLYGAFAYDLAFQFE 176
gi 499303815  88 LPVIFECLSKSEQLQKLTEHHHKITGLVKSTpEFFAEEERSKQPSTFTVIREILHIFSSQEDEHLGLYGAFGYDLVFQFE 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136328    173 AIELKLSRPDDQRDMVLFLPDEILVVDHYAAKAWIDRYDFARENLSTEGKAADIAPEPFRSVDSIPPH-GDHRPGEYAEL 251
gi 1717765   177 PIRQRLERPDDQRDLLLYLPDRLVALDPIAGLARLVAYEFITAAGSTEGLECGGRDHPYRPDTNAEAG-CDHAPGDYQRV 255
gi 499303815 168 QITQCLERPQDQRDLVLYLPDELIVVDYYQQQAFRLEYDFITAHGSTYDLPRTGESVDYRGQCLTPPQnADHKIGEYAKL 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136328    252 VVKAKESFRRGDLFEVVPGQKFYERCESRPSEISNRLKAINPSPYSFFINLGNQEYLVGASPEMFVRVSGRRIETCPISG 331
gi 1717765   256 VESAKAAFRRGDLFEVVPGQTFAEPCADAPSSVFRRLRAANPAPYEAFVNLGRGEFLVAASPEMYVRVAGGRVETCPISG 335
gi 499303815 248 VEFALDYFRRGDLFEVVPSQNFFTACEAPPSQLFETLKQINPSPYGFIFNLG-GEYIIGASPEMFVRVEGRRVETCPISG 326
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136328    332 TIKRGDDPIADSEQILKLLNSKKDESELTMCSDVDRNDKSRVCVPGSVKVIGRRQIEMYSRLIHTVDHIEGRLRDDMDAF 411
gi 1717765   336 TVARGADALGDAAQVLRLLTSAKDAAELTMCTDVDRNDKARVCEPGSVRVIGRRMIELYSRLIHTVDHVEGRLRSGMDAL 415
gi 499303815 327 TITRGHDAIDDAVQIRQLLNSHKDEAELTMCTDVDRNDKSRICEPGSVKVIGRRQIELYSHLIHTVDHVEGILRPEFDAL 406
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136328    412 DGFLSHAWAVTVTGAPKLWAMRFIESHEKSPRAWYGGAIGMVGFNGDMNTGLTLRTIRIKDGIAEVRAGATLLYDSNPEE 491
gi 1717765   416 DAFLTHSWAVTVTGAPKRWAMQFLEDTEQSPRRWYGGAFGRLGFDGGMDTGLTLRTIRMAEGVAYVRAGATLLSDSDPDA 495
gi 499303815 407 DAFLSHTWAVTVTGAPKRAAIQFIEKNERSVRRWYGGAVGYLNFNGNLNTGLILRTIRLQDSIAEVRVGATLLYDSIPQA 486
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136328    492 EEAETELKASAMIAAIRdAKSANSAKSARDVAAVG-------AGVSILLVDHEDSFVHTLANYFRQTGASVTTVRTPVAE 564
gi 1717765   496 EDAECRLKAAAFRDAIR-GTAAGAAPTLPAAPRGG-------EGRRVLLVDHDDSFVHTLADYLRQTGASVTTLRHSHAR 567
gi 499303815 487 EEQETITKAAAAFETIRrAKQIDPQIEESSTRKLSkylpdgqSGKHILLIDHEDSFVHTLANYIRSTGATVTTLRHGFSE 566
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136328    565 EIFDRVKPDLVVLSPGPGTPKDFDCKATIKKARARDLPIFGVCLGLQALAEAYGGDLRQLAIPMHGKPSRIRVLEPg-IV 643
gi 1717765   568 AALAERRPDLVVLSPGPGRPADFDVAGTIDAALALGLPVFGVCLGLQGMVERFGGALDVLPEPVHGKATEVRVLGG--AL 645
gi 499303815 567 SLFDTERPDLVVLSPGPGRPSEFKVQETVAACVRRQIPLFGVCLGLQGIVEAFGGELGVLNYPQHGKSSRIFVTAPdsVM 646
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 136328    644 FSGLGKEVTVGRYHSIFADPSNLPREFVITAESEDGTIMGIEHSKEPVAAVQFHPESIMTLGGDAGMRMIENVVAHLAKR 723
gi 1717765   646 FAGLPERLTVGRYHSLVARRDRLPADLTVTAETADGLVMAVEHRRLPLAAVQFHPESILSLDGGAGLALLGNVMDRLAAG 725
gi 499303815 647 FQDLPESFTVGRYHSLFALSQRLPKELKVTAISDDEVIMAIEHQTLPIAAVQFHPESIMTLAGEVGLMMIKNVVQKYTQS 726

                 ....*.
gi 136328    724 AKTKAA 729
gi 1717765   726 ALTDAA 731
gi 499303815 727 QQSTVP 732
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap