1ZOY


Conserved Protein Domain Family
sdhA_forward

?
TIGR01816: sdhA_forward 
Click on image for an interactive view with Cn3D
succinate dehydrogenase, flavoprotein subunit, E. coli/mitochondrial subgroup
Succinate dehydrogenase and fumarate reductase are homologous enzymes reversible in principle but favored under different circumstances. This model represents a narrowly defined clade of the succinate dehydrogenase flavoprotein subunit as found in mitochondria, in Rickettsia, in E. coli and other Proteobacteria, and in a few other lineages. However, this model excludes all known fumarate reductases. It also excludes putative succinate dehydrogenases that appear to diverged before the split between E. coli succinate dehydrogenase and fumarate reductase. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 130875
View PSSM: TIGR01816
Aligned: 7 rows
Threshold Bit Score: 990.034
Threshold Setting Gi: 15805976
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZOY_A        38 LSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNME-EDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGM 116
gi 399372     30 MAKEGLNTACITKIFPTRSHTVAAQGGISAALGNMG-EDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGV 108
gi 499289585  26 LSKSGLNCAVLSKVFPTRSHTVAAQGGISASLGNVQ-EDRWDWHMYDTVKGSDWLGDQDAIEFMCRAAPEAVIELEHMGM 104
gi 1169337    80 LSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNME-EDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGM 158
gi 489177895  27 LAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIASADpNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGL 106
gi 499190057  23 AAKGGVSVACISKLYPTRSHTGAAQGGIGAALGNIQ-EDHWEWHMFDTIKGGDYLTDQDAAEVFSKDIIEVVYELEHMGL 101
gi 489512424  25 AGPR-VRTAVLTKLYPTRSHTGAAQGGMCAALANVE-DDNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGM 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZOY_A       117 PFSRTEDGKIYQRAFGGQSLKFGKGgQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLM-E-NGE----CR 190
gi 399372    109 PFSRTVDGKIYQRPFGGMTTEYGKGkAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFIEYFAIDLLM-E-DGE----CR 182
gi 499289585 105 PFDRVESGKIYQRPFGGHTAEHGKR-AVERACAVADRTGHAMLHTLYQQNVRANTQFFVEWTAQDLIRdE-NGD----VV 178
gi 1169337   159 PFSRTEDGKIYQRAFGGQSLKFGKGgQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLM-E-NGE----CR 232
gi 489177895 107 PFSRTETGRIYQRPFGGQSKDFGKGgQAARTCAAADRTGHALLHTLYQANLKNGTSFLNEWYAVDLVK-NqDGA----VV 181
gi 499190057 102 PFSRTPEGKIAQRKFGGHTRDFGKA-AVERSCYAKDRTGHMILQTLYQQNVKAGTLFFNEFHVTDLII-E-DGR----CR 174
gi 489512424 103 PFNRTPEGRIDQRRFGGHTRDHGKA-PVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDLAL-T-QTPsgpvAT 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZOY_A       191 GVIALCIEDGSIHRIRARNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCR 270
gi 399372    183 GVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMVIRAGLPLQDMEFVQFHPTGIYSAGCLITEGAR 262
gi 499289585 179 GVTAMEMETGEVYIFHAKAVMFATGGGGRIYASSTNAYMNTGDGLGICARAGIPLEDMEFWQFHPTGVAGAGVLITEGVR 258
gi 1169337   233 GVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCR 312
gi 489177895 182 GIIAICIETGETVYIRSKAVVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIEMWQFHPTGIAGAGVLVTEGCR 261
gi 499190057 175 GVVAYDLATGELHTFHAKAVILAAGGYGRVFKITSNALTLTGDLMSIYYRKGLPLQDMEFYQFHPTGLAKLGILVTEGIR 254
gi 489512424 180 GVIAYELATGDIHVFHAKAVVIATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFHQFHPTGLAGLGILISEAVR 259
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZOY_A       271 GEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLAVRLPGISETAMIFAG 350
gi 399372    263 GEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIEIREGRGVGEHKDHVFLHLNHLSPEILHRRLPGISETAKIFAG 342
gi 499289585 259 GEGGILLNADGERFMERYAPTVKDLASRDVVSRAMAMEIYEGRGCGKNKDHVLLKIDHIGAEKIMEKLPGIREISIQFAG 338
gi 1169337   313 GEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAG 392
gi 489177895 262 GEGGYLINAHGERFMERYAPNAKDLAGRDVVARSMVKEVLAGNGVGPNKDHVLLKLDHLGEEVLHSRLPGICELSKTFAH 341
gi 499190057 255 GEGGILRNSNGERFMERYAPTIKDLAPRDIVARSMTTEIREGRGVGKDKDAIHIDLTHLPREVIEGKLAEITDLARTYLG 334
gi 489512424 260 GEGGRLLNGEGERFMERYAPTIVDLAPRDIVARSMVLEVLEGRGAGPLKDYVYIDVRHLGEEVLEAKLPDITEFARTYLG 339
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZOY_A       351 VDVTKEPIPVLPTVHYNMGGIPTNYKGQVLR-HVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSI 429
gi 399372    343 VDVTKDPIPVLPTVHYNMGGIPTNYQGQVIIkDGKNHNSIVNGIMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSALKA 422
gi 499289585 339 IDPIKDPIPVVPTTHYMMGGIPTNYHGEVVVpQGEDYEVPVKGLYAAGECACASVHGANRLGTNSLLDLVVFGKAAGDSM 418
gi 1169337   393 VDVTKEPIPVLPTVHYNMGGIPTNYKGQVLR-HVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSI 471
gi 489177895 342 VDPVVAPIPVIPTCHYMMGGVATNIHGQAITqDANGNDQIVEGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLHL 421
gi 499190057 335 QDPVKDLVMVQPTAHYAMGGIPTDLNGLCLS-DGNG--GSIEGLYAAGEQACVSLHGANRLGTNSLGDLVVFGRRAGRYA 411
gi 489512424 340 VDPVTELVPVYPTCHYLMGGIPTTVTGQVLR-D---NTSVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAA 415
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZOY_A       430 AESCRPGDKVPSIKPNAGEESVMNLDKLRFANGTIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKILRLYGDLQHLKT 509
gi 399372    423 AELIKPASPHKPLQKETLEKIINRFDKVRYANGNILVADLRLKMQRTMQSHVSVFRTQKLLDEGVGMISEIRNRYKDIKI 502
gi 499289585 419 IKFIKEQSDWKPLPANAGELTRQRIERLDNQTDGENVDALRRELQRSVQLHAGVFRTDEILSKGVREVMAIAERVKRTEI 498
gi 1169337   472 EESCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKT 551
gi 489177895 422 EKALKEGIDARGASESDLEASFKRLNGVNERTSGEEVAPLKRELQSCMQNYFGVFRTGEYMQKGIAQLADLRERIANVKI 501
gi 499190057 412 AEYAK-QVEYAEMPENAEAESRRVFDDLRAASGKDNAAAIRKELQETMMRNVGIFRNGPDMAKQVEIIKELKTRYKNVGV 490
gi 489512424 416 ASYAQ-GHDFVDMPPNPEAMVVGWVSDILSEHGNERVADIRGALQQSMDNNAAVFRTEETLKQALTDIHALKERYSRITV 494
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZOY_A       510 FDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKERVDeydyskpiqgqqkkpfqE----------- 578
gi 399372    503 NDKSLIWNSDLVEALELDNLLDQALVTVCSAAARKESRGAHAREDYPDRND-----------------R----------- 554
gi 499289585 499 KDKSKVWNTARIEALELDNLIEVAKATLVSAEARKESRGAHASDDHPERDD-----------------E----------- 550
gi 1169337   552 FDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRID-----------------Eydyskpiqgqq 614
gi 489177895 502 NDKSQAFNTARIEALELQNLLEVAEATAIAAEHRKESRGAHAREDFEERDD-----------------E----------- 553
gi 499190057 491 SDTNARYNSELVEALELGFMLDCAEAMASSAVNRTESRGAHDREDFHQRDD-----------------V----------- 542
gi 489512424 495 HDKGKRFNTDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDYPNRDD-----------------V----------- 546
                        570       580       590       600       610
                 ....*....|....*....|....*....|....*....|....*....|...
1ZOY_A       579 ------HWRKHTLSYVDVkT---GKVSLEYRPVIDKTLNEADCAtvpPAIRSY 622
gi 399372    555 ------DWIKHTLSSIDD-S---GKVVLDYKPVTLTTLTDAISAi-pPVKRVY 596
gi 499289585 551 ------NWMKHTLYHSDIn-------TLSYKPVHTKPLSVEYIK---PAKRVY 587
gi 1169337   615 kkpfeeHWRKHTLSYVDVgT---GKVTLEYRPVIDKTLNEADCAtvpPAIRSY 664
gi 489177895 554 ------NWLCHTLYFP-------GEKRVSKRSVNFAPKTVPAFE---PKVRTY 590
gi 499190057 543 ------NWLKHTMAYRDMnNp--GNVLIGYKDVALKGFTRS-FE---PKPRVY 583
gi 489512424 547 ------NYMRHTMAYKEIgAdkeGPELRSDVRLDFKPVVQTRYE---PKERKY 590
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap