3C3D


Conserved Protein Domain Family
F420_cofD

?
TIGR01819: F420_cofD 
Click on image for an interactive view with Cn3D
2-phospho-L-lactate transferase
This model represents LPPG:Fo 2-phospho-L-lactate transferase, which catalyses the fourth step in the biosynthesis of coenzyme F420, a flavin derivative found in methanogens, the Mycobacteria, and several other lineages. This enzyme is characterized so far in Methanococcus jannaschii but appears restricted to F420-containing species and is predicted to carry out the same function in these other species. The clade represented by this model is one of two major divisions of proteins in pfam01933. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 130878
View PSSM: TIGR01819
Aligned: 7 rows
Threshold Bit Score: 410.673
Threshold Setting Gi: 308376049
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C3D_A         2 IIFSGGTGTPKLLDGLKEILP-------------EEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIEN 68
gi 499344270   2 IIFSGGTGTPKLLDGLKEILP-------------EEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIEN 68
gi 499173182   6 TVLSGGTGTPKLLQGLKRVVN-------------NEELAVIVNTGEDTWIGDLYLSPDVDTVLYTLADLINEETWYGVKE 72
gi 499180877   2 LVLSGGTGTPKLLQGLKEV----------------ADFWVVVNTAEDVWVSGNKICPDIDSVIYAIAEVIDDEKWWGIKG 65
gi 490012269   8 TVLAGGVGGARFLLGVQQLLGlgqfaansahsdaDHQLSAVVNVGDDAWIHGLRVCPDLDTCMYTLGGGVDPQRGWGQRD 87
gi 499205500   3 TFLAGGTGTPKLLAGARRVFD-------------PAETTVVGNTGDDVALGGLLVCPDLDTVLFEGGGVLDRETWWGIAD 69
gi 490073600   4 VVLAGGIGGARFLRGLRQAAP-------------DADITVIGNTGDDIHLFGLKVCPDLDTVMYTLGGGINEEQGWGRAD 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C3D_A        69 DTFGTYERXKELGI--------------------------------EEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKL 116
gi 499344270  69 DTFGTYERMKELGI--------------------------------EEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKL 116
gi 499173182  73 DTFYTHEQLKNLGF--------------------------------DEVLRIGDKDRALKMHKTYYLKRGHKLSEVVDME 120
gi 499180877  66 DTFHTHERLKELGF--------------------------------DEGMRIGDLDRATHILRSEMLRAGKSLCEATKAV 113
gi 490012269  88 ETWHAMQELVRYGVq-------------------------------PDWFELGDRDLATHLVRTQMLQAGYPLSQITEAL 136
gi 499205500  70 DGSTTHDYLTDLAAaadidpdtprylpddaqtagrdiarwrrfsaaSEFMFIGDRDRAVHTLRAGLLDEGHTLTEVTRRL 149
gi 490073600  71 ETFHLKEELAAYGVg-------------------------------PEWFGLGDRDFATHIVRTQMITAGFPLSAVTEAL 119
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C3D_A       117 SSLFGIKANILPXSDD--PVSTYIETA----EGIXHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIG 190
gi 499344270 117 SSLFGIKANILPMSDD--PVSTYIETA----EGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIG 190
gi 499173182 121 KVALGIKAKVIPMTDDrvETKILAKVDg--kVDLLKFHDFWVKRKGDVEVLDVIYENSLYAKPCEKAVEAIKNSDLVIIG 198
gi 499180877 114 AEAYGVKQEIFPMCEE--EVSTTVVTD----EGEMHFQEFWVLRRGEPEVKDVYFRGIEKARIPDEVKERLRKEKEVLIG 187
gi 490012269 137 CDRWQPGARLLPATDDrcETHVVITDPvdesRKAIHFQEWWVRYRAQVPTHSFAFVGAEKSSAATEAIAALADADIIMLA 216
gi 499205500 150 ADAFDLSVDLVPMSND--PVATIVQTP----DGEQHFQTFWVAEHGDPTVEDVEFRGGERATAAQPAIEAIRDGP-VVVG 222
gi 490073600 120 CDRWKPGVRLIPMTDDrvETHVAVELDg--eRKAVHFQEYWVRLRASVPAEAVVPVGAEQAKPAPGVLEAIGEADVILFP 197
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3C3D_A       191 PSNPITSIGPIISLPGXRELLKK--K--KVVAVSPIIGNAPVSGPAGKLXPACGIEVSSXGVAEYYQD-----F-LDVFV 260
gi 499344270 191 PSNPITSIGPIISLPGMRELLKK--K--KVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQD-----F-LDVFV 260
gi 499173182 199 PSNPITSIGPILSLNGIKELLKD--K--KVVVVSPIVGNSAVSGPAGKLMKAKGYDVSVKGIYEFYKD-----I-VDVLV 268
gi 499180877 188 PSNPITSILPILSVEDFRERLRD--K--KVIAISPIVGEKAVSGPAGKLMRAKGYEVSARGVADVYAD-----F-LDLLV 257
gi 490012269 217 PSNPVVSIGAILAVPGIRAALREatA--PIVGYSPIIGEKPLRGMADTCLSVIGVDSTAAAVGRHYGArcatgI-LDCWL 293
gi 499205500 223 PSNPVTSIGPMLALDGIADALRD--A--QVVAVSPFVEDEVFSGPAAKLMAAVGHDPSTAGVADAY-D-----F-ADAFV 291
gi 490073600 198 PSNPVVSIGTILAVPGIREAIAD--AgvPVVGLSPIVGDAPVRGMADKVLAAVGVESTAAAVAEHYGS-----GlLDGWL 270
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|.
3C3D_A       261 FDERDRADEFAferlGCHASRADTLXTSTEKSKELAEIVVQ 301
gi 499344270 261 FDERDRADEFAferlGCHASRADTLMTSTEKSKELAEIVVQ 301
gi 499173182 269 IDNVDKEIAKEi---PCEVLITNTIMKTLDDKVRLAKNIIE 306
gi 499180877 258 VDEADKGVMER-------SVATNTIMKTKEDAVRLAEFVVK 291
gi 490012269 294 VHDGDHAEID-----GVTVRSVPLLMTDPNATAEMVRAGCD 329
gi 499205500 292 LDTADSTDLDR------PVVRTDTSLDTEADAERVARACRD 326
gi 490073600 271 VDTVDADAVTRvraaGVLCRAVPLMMTDLDATAQMAREALT 311
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap