1FC4


Conserved Protein Domain Family
2am3keto_CoA

?
TIGR01822: 2am3keto_CoA 
Click on image for an interactive view with Cn3D
glycine C-acetyltransferase
This model represents a narrowly defined clade of animal and bacterial (almost exclusively Proteobacterial) 2-amino-3-ketobutyrate--CoA ligase, now called glycine C-acetyltransferase. This enzyme can act in threonine catabolism. The closest homolog from Bacillus subtilis, and sequences like it, may be functionally equivalent but were not included in the model because of difficulty in finding reports of function. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130881
View PSSM: TIGR01822
Aligned: 6 rows
Threshold Bit Score: 715.044
Threshold Setting Gi: 14278152
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FC4_A         8 FYQQLTNDLETARAEGLFKEERIITSAQQADITVaDG--SHVINFCANNYLGLANHPDLIAAAKAGXDSHGFGXASVRFI 85
gi 6685545    27 LRGILEGELEGIRGAGTWKSERVITSRQGPHIRV-DGvsGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFI 105
gi 499346614   8 LTAHYAAELESIQSQGLFKSERIITGPQSAQITLaDG--RSVLNFCANNYLGLADHPDIIQAAKDALDTHGFGMASVRFI 85
gi 490722450   5 MKDYLAAELKSIEEAGLYKKERIIITPQRADIRVnEG--QEVLNFCANNYLGLSDHPRLIQAAKDAMDERGFGMSSVRFI 82
gi 499313478   7 FYAFIRTELDAIREAGLFKQERVIASPQGARVRTiDG--REVINLCANNYLGLSSHPRVIDAAHEALRTHGFGLSSVRFI 84
gi 585345      5 FYQQLTNDLETARAEGLFKEERIITSAQQADITVaDG--SHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFI 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FC4_A        86 CGTQDSHKELEQKLAAFLGXEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDXQELE 165
gi 6685545   106 CGTQSIHKNLEAKIARFHQREDAILYPSCYDANAGLFEALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLE 185
gi 499346614  86 CGTQDLHKQLERTIADFFGTEDTILYAACFDANGGLFEPLLGEHDAIISDALNHASIIDGVRLCKAKRFRYANCDMADLE 165
gi 490722450  83 CGTQDIHKELEKAIAEYFHTEDTILYAACFDANGGVFEPLFGEEDAIISDALNHASIIDGVRLCKAKRYRYENANMEDLE 162
gi 499313478  85 CGTQDLHKTLEARLSAFLGTEDTILYGSAFDANGGLFETLLGAEDAVISDALNHASIIDGIRLCKARRYRYQHNDLDDLR 164
gi 585345     83 CGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELE 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FC4_A       166 ARLKEAREAgaRHVLIATDGVFSXDGVIANLKGVCDLADKYDALVXVDDSHAVGFVGENGRGSHEYCDVXGRVDIITGTL 245
gi 6685545   186 AKLQEAQKH--RLRLVATDGAFSMDGDIAPLQEICCLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTL 263
gi 499346614 166 TQLQAADAAgcKTKLITSDGVFSMDGFIAPLDEITALARKYNALVHIDECHATGFLGATGRGSAEVKGVMDQIDIFTGTL 245
gi 490722450 163 RVLKEAQAQ--RYRIIVTDGVFSMDGNVAPMDKICDLAEKYDAMVMVDECHSAGVVGATGRGVAEQFDCYGRIDIHTGTL 240
gi 499313478 165 AQLTQARADgaRHLLVFTDGVFSMDGTIARLDEMRSICDAHGALLGIDECHATGFLGPRGRGTHELRGVFGKVDIITGTL 244
gi 585345    163 ARLKEAREAgaRHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTL 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FC4_A       246 GKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEXVEAGSELRDRLWANARQFREQXSAAGFTLAG 325
gi 6685545   264 GKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISG 343
gi 499346614 246 GKAMGGALGGFTTAKREVIELLRQRSRPYLFSNSLPPHVVAAGIKAFEMLDAAGELRTQLVENTRYFRERMTAAGFDVKP 325
gi 490722450 241 GKAFGGAIGGFTTGPKEVIAMLRQRSRPYLFSNSIPPSVVGAGLEVFKMLKESNDLHTKLMENVNYFRDRMLAAGFDIKP 320
gi 499313478 245 GKALGGASGGFTSARKEVVALLRQRSRPYLFSNTVAPAIIGASIAVLDILEGSTELRDRLERNTRFFRAGLEALGFDVKP 324
gi 585345    243 GKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAG 322
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
1FC4_A       326 ADHAIIPVXLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQXSAAHTPEQITRAVEAFTRIGKQLGVI 400
gi 6685545   344 ASHPICPVMLGDARLASRMADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRLHGAL 418
gi 499346614 326 GVHPISPVMLYDAPLAQRFAERLLEEGIYAIGFFFPVVPKGQARIRTQISAAHTREQLDQAIDAFTRIGHELKVI 400
gi 490722450 321 TQSAICAVMLYDAKLSQDYAARLLEEGIYVTGFYYPVVPKGQARIRVQLSAGHEREHLDKAINAFIKVGRELGVI 395
gi 499313478 325 GEHPIIPIMVYDADKAQQLAQRLLELGVYVVGFFYPVVPKGQARIRVQMSAVHDEAALQAALGAFGQAGHELGLI 399
gi 585345    323 ADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVI 397
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap