Conserved Protein Domain Family
PabB-clade2

?
TIGR01824: PabB-clade2 
aminodeoxychorismate synthase, component I, clade 2
This clade of sequences is more closely related to TrpE (anthranilate synthase, TIGR00564/TIGR01820/TIGR00565) than to the better characterized group of PabB enzymes (TIGR00553/TIGR01823). This clade includes one characterized enzyme from Lactococcus and the conserved function across the clade is supported by these pieces of evidence: 1) all genomes with a member in this clade also have a separate TrpE gene, 2) none of these genomes contain an aparrent PabB from any of the other PabB clades, 3) none of these sequences are found in a region of the genome in association with other Trp biosynthesis genes, 4) all of these genomes aparrently contain most if not all of the steps of the folate biosynthetic pathway (for which PABA is a precursor). Many of the sequences hit by this model are annotated as TrpE enzymes, however, we believe that all members of this clade are, in fact, PabB. The sequences from Bacillus halodurans and subtilus which score below the trusted cutoff for this model are also likely to be PabB enzymes, but are too closely related to TrpE to be separated at this time.
Statistics
?
PSSM-Id: 130883
View PSSM: TIGR01824
Aligned: 7 rows
Threshold Bit Score: 403.384
Threshold Setting Gi: 21220046
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134741   131 GGWLGWLGYDTAWAIEKLPYSKADDLPFPVAYWYEPENFVILDH-Q-------EQLLWLATTDQEKIKFFQT-----QLA 197
gi 129530    100 GGALGYFAYDVGRRLEGYNDLGIEDWAIPDLAGSSYEIGVSADH-Qn------DVIVLIAHASADGNDVFITssrqlSMV 172
gi 500031405  22 AQRQAEQAEQVAPLLR--WADVQAHQGHWVAGYVRYEAACAWDL-P----------VHPTTQPLAWFGCYAP-----PQP 83
gi 492680148  96 GGWAVLLDYELAAQVEPILQLPTRRDGVPTALALRAPAAVLRDRlH-------GRCVALAE-PGREE-LLQQigddlAAC 166
gi 499204697 104 GGLFGWLSYDIARELEAIPDTTTDARGLPRLQLGVYPTIAAWRE-PftpgddlRLIAAVPVDEYTPDGAFEAgrdrvQSL 182
gi 499223250 164 GGVVGLGAYELGDRVE---DLGLSRTDWPDLTCARYPALLAFDH-Ha------RQVIAVGRGEAEAEAN-ARaadalAWL 232
gi 499338133  11 GDRLATGLLDVTSD----PAALESEGFWAVCADFEGGLTCARFA-E----------VRTEPVPAPTPGEWRG-----PAV 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134741   198 DKINSVSSPQVPPLN--LTYT----TDQDQYETMVNQAKQYIKAGDIFQANLTLRFIAKt--eQKLnsWQVYQHLQTINP 269
gi 129530    173 AGPTCCASGDVEILRnkLHYYg--vIPFSQDDCGFNRLKDYLGSGDMYQVNLGNRNVGAi--vMTL--FQGYNQLRLMNP 246
gi 500031405  84 ACYPHLPT----PPPvtLELL----IQQARYDQDLKRILDFIHAGDTYQVN----HTVRalphFEGtlLDLFLDRQARYR 151
gi 492680148 167 AALPPLPAW-AGPLAvdEEA-------PERFTGAVERVLDYLRAGDVFQANISRAWHAAf--aAVVdpAALHARLRAANP 236
gi 499204697 183 AAAIRDGDPAVGPPPadSPAPfesvAGRAAFESRVRRIQDAIRDGDTFQANVSHRLDAP----AAVhpVAVFEALRDTNP 258
gi 499223250 233 EVAAPERAEPAGPLCadLVAS-----DPATYETAVAQVVARIVGGEIFQANIARAWTGRl--aAGVdpFDLFVRLRAQSP 305
gi 499338133  71 GDWTS---------------S----LDRAAYTTGVRRIRAHIAAGEVYQANLCRVLTAPigpgADVdaLTALLARGNPAP 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134741   270 SPFASYWRSPWgdVVSCSPERLVKLEGN-VAQTRPIAGTRARGKNLAEDEQLLQELLVNTKELAEHIMLVDLERNDLGRV 348
gi 129530    247 GPYMVFLDEAN--IIMASPEIVLADEAN-DLNTRPIAGTLMRLNEQDEDGVNAACLGQHHKDRAEHMMIVDLVRNDLGRV 323
gi 500031405 152 FPYAIWLESPGtsVASLSPELFLHRQGS-LVTTAPIKGTRPRGETLAEDQQLAMALSQASKDAAEHIMIVDMARNDLGRV 230
gi 492680148 237 APFAGLFVAAGraVASSSPERLVSVQGD-VVQTRPIAGTRARFAG-DDDAARIRELVGHPKERAEHVMLIDLERNDLGRI 314
gi 499204697 259 APYSGIVEFPGvdLVSASPELLLARRGR-ELTTEPIAGTRPRGATPAEDDAARAALRADDKERAEHAMLVDLERNDLGKV 337
gi 499223250 306 APFSAYWRLPGraLVSNSPERFLKLDAAgAIQTQPIKGTRPRGRDPVEDRALAAELLASDKDRAENLMIVDLMRNDLARV 385
gi 499338133 132 YAGTIRLPEHGveIATASPELFLRRDGR-TVESGPIKGTGRTEADLLE------------KDYAENVMIVDLVRNDLGRV 198
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134741   349 CTWGTVEVDELLAIERYSHVSHLVSNVKGILQPDKTGVDLVKALFPGGTITGCPKIRCLEIIEELEPVRRSLFYGSCGYW 428
gi 129530    324 GRFGSVNVQEIVGAENYSVVMHIVSRVTGSLNEAFEAMEIIRAGFPGGSITGAPKVRAMEIIEELEPQRRDGWGGSIGYI 403
gi 500031405 231 CETGTIRVPHLKNRRSFATVHHLESRVEGRLREGLDLAHLFEALFPAASITGAPKKRTMEIIKSLEPQPRSLYTGCVGVI 310
gi 492680148 315 CAPGTVEVDELMCVESYAHVHHIVSNVRGRLRAGVTPGEVIAAVFPGGTITGCPKVRCMQVIAELEQTARGAYTGAFGWL 394
gi 499204697 338 SEYGSVAVPDYRRVDAYSEVLHLVSEVTGRLRDSCSLRDAIAAVFPGGTITGAPKPRTMALIDTVEATRRGPYTGSLAAI 417
gi 499223250 386 SPAGSVRAPELFKVESFANVHHLVSTVTARLAPGRGVADLLRASFPPGSITGAPKVQAMKVIAELEP-PRGPYCGSLFWA 464
gi 499338133 199 CATGTVTVPDLCAVEKHPGLVHLVSTVRGELPADAGWPDLLDAAFPPGSVTGAPKSSALRIIDALETAPRGPYCGGVGWV 278
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 8134741   429 DQR-GNLDLNILIRTL-----L-FTSGQVTGQVGAGIVADSDPAKEWLESLQKAKAL 478
gi 129530    404 AYR-GNIGYRIAIRTL-----F-ACNGQLFASSGAGLVGDSMEDGEYNETFEKMRAL 453
gi 500031405 311 RPG-GEALFNVAIRTL-----EqQGHTPPLLGLGGGIVADSQPLDEWQELAHKGGFL 361
gi 492680148 395 NRD-GDMDLNILIRTA-----E-VAGHHVHFRTGAGIVVDSDPQRELDETRAKARGV 444
gi 499204697 418 GFD-GDATLSITIRTL-----V-RRAATYHLRVGAGIVHDSTPAAEYDETLAKARAL 467
gi 499223250 465 GVD-GAFDSSVLIRTVgl-vqD-GAGWRLEARAGAGIVADSDPRGERLETEAKIAAL 518
gi 499338133 279 DADrGTGGLAVGIRTFwleraA-GGEARLRFGTGAGITWGSDPEGEWRETELKAARL 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap