Conserved Protein Domain Family
gly_Cac_T_rel

?
TIGR01825: gly_Cac_T_rel 
pyridoxal phosphate-dependent acyltransferase, putative
This model represents an enzyme subfamily related to three known enzymes; it appears closest to glycine C-acteyltransferase, shows no overlap with it in species distribution, and may share that function. The three closely related enzymes are glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase), 5-aminolevulinic acid synthase, and 8-amino-7-oxononanoate synthase. All transfer the R-group (acetyl, succinyl, or 6-carboxyhexanoyl) from coenzyme A to an amino acid (Gly, Gly, Ala, respectively), with release of CO2 for the latter two reactions.
Statistics
?
PSSM-Id: 130884
View PSSM: TIGR01825
Aligned: 4 rows
Threshold Bit Score: 671.146
Threshold Setting Gi: 380742510
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6685543     8 LKAELNSMKENHTWQDIKQLESMQGPSVTVNHQKVIQLSSNNYLGFTSHPRLINAAQEAVQQYGAGTGSVRTIAGTFTMH 87
gi 446172969   9 LEENINYLKENGLYNEIDTIEGANGPEIKINGKSYINLSSNNYLGLATNEDLKSAAKAAIDTHGVGAGAVRTINGTLDLH 88
gi 499191432  38 LRQDLAGLRESGLLISPRVLDAPQRARTRVDGREVVNLASNNYLGFADHPRLKERAAQYLQQWGVGAGAVRTIAGTLRIH 117
gi 380742510   7 ikeeleelkkkGLYVTIRVLQSAQGPWVVVNGKRVLNMCSNNYLGLAAHPKIKEAAIRAILDYGVGAGAVRTIAGTMELH 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6685543    88 QELEKKLAAFKKTEAALVFQSGFTTNQGVLSSILSKED--IVISDELNHASIIDGIRLTKADKKVYQHVNMSDLERVLRK 165
gi 446172969  89 DELEETLAKFKGTEAAIAYQSGFNCNMAAISAVMNKND--AILSDELNHASIIDGCRLSKAKIIRVNHSDMDDLRAKAKE 166
gi 499191432 118 EDFERQLADFKHTGSALVLHSGFSTNQGVLGGLLREGD--LVVSDELNHASIIDGLRLTKATKKIYKHADPADLDRVLRE 195
gi 380742510  87 VELEEKLAKFKKREAAILFQSGYNANLGAISALLRKGEdgIFLSEELNHASIIDGMRLSGAPKVIYKHLDMDDLKKKLEE 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6685543   166 SMN---YRMRLIVTDGVFSMDGNIAPLPDIVELAEKYDAFVMVDDAHASGVLGeNGRGTVNHFGLD-GRVHIQVGTLSKA 241
gi 446172969 167 AVEsgqYNKVMYITDGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSGVMG-KGAGTVKHFGLQ-DKIDFQIGTLSKA 244
gi 499191432 196 NPS---EGLKLVVTDGVFSMDGDVAPLDKLVEVARRYGAVTYVDDAHGSGVMGeAGRGTVHHFGFEyADDVIQVGTLSKA 272
gi 380742510 167 NKD---KKKKIIVTDGVFSMDGDLAPLPEIVELAEQYDAIVYVDDAHGEGVLGsHGRGIVDHFNLH-DKVDFEMGTLSKA 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6685543   242 IGVLGGYAAGSKVLIDYLRHKGRPFLFSTSHPPAVTAACMEAIDVLLEEPEHMERLWENTAYFKAMLVKMGLTLTKSETP 321
gi 446172969 245 IGVVGGYVAGTKELIDWLKAQSRPFLFSTSLAPGDTKAITEAVKKLMDSTELHDKLWNNAQYLKNGLSKLGYDTGESETP 324
gi 499191432 273 WGGVGGYAAGHPDLRELLINRARPYLFSTAQPPAVVGALAAALDEVQRDPSLMERLWDNTRFFKAELGRLGFDTLGSVTP 352
gi 380742510 243 FGVIGGYVAGPEEAIEYLKQRARPFLFSSAMNPPDVAAAIAAVEILQKSDDLVKKLWDNTHFLQKGLRDLGYDLGNTKHP 322
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 6685543   322 ILPILIGDEGVAKQFSDQLLSR-GVFAQSIVFPTVAKGKARIRTIITAEHTKDELDQALDVIEKTAKELQLL 392
gi 446172969 325 ITPVIIGDEKTTQEFSKRLKDE-GVYVKSIVFPTVPRGTGRVRNMPTAAHTKDMLDEAIAAYEKVGKEMKLI 395
gi 499191432 353 ITPVVFGEASAAFEASRRLFDL-GIFAVGLGFPTVPRDLARIRNIVTAEHTRDDLEQALSAYQQVGRDLGVI 423
gi 380742510 323 ITPVMLYDEKLAQEFSRRLYEEyNIFAQAIVYPTVPLGTARIRLEPSAAHTKEDLKLVIDAFEDLGKKTGFL 394
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap